KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_13635Help
Entry
BAMTA208_13635    CDS       T01824                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:baz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BAMTA208_13635 (ruvA)
Enzymes [BR:baz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BAMTA208_13635 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2597914..2598519)
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVSPQYIVIENGGIGYQVFTPNPFIYKVSNQETIFTYHHIKEDAFSLYGF
STREEKALFTKLLNVTGIGPKGALAILGSGDPGAVIEAIEQEDEAFLVKFPGVGKKTARQ
IILDLKGKLADVVPEMIDNLFNHEARIEKQEAETALDEALEALRVLGYAEKEIKKVLPHL
KEETALSTDQYVKKALQKLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaattcgtgaaggggacgattgattacgtatcgccccaatacatcgtgattgaa
aacggcgggatcggctatcaggtcttcactccgaatccgtttatttataaggtaagcaat
caagagaccatttttacgtatcatcatataaaagaagacgccttttctttgtatggcttt
tcaacccgggaagaaaaagcgcttttcacaaagctgctgaatgtcaccggcatcggtccg
aaaggggcgctcgccattctcggttccggtgatccgggagccgtcatcgaagcgatcgaa
caggaagatgaagcctttttggtgaaatttcctggtgtgggcaaaaaaacggcacggcag
attattcttgatttgaaaggcaaactggccgatgtcgtgcctgaaatgattgacaacctg
ttcaatcatgaagcgcgcattgaaaaacaagaggctgaaacggcgcttgatgaggcgctt
gaagcgctcagggtactcggctacgccgaaaaagaaattaaaaaagtgcttcctcactta
aaagaggaaacggcgctttcaacagaccaatatgtgaaaaaagcattgcaaaaattatta
aagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system