KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_13810Help
Entry
BAMTA208_13810    CDS       T01824                                 

Gene name
hemD3
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BAMTA208_13810 (hemD3)
Enzymes [BR:baz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BAMTA208_13810 (hemD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2630519..2631301)
Genome map
AA seq 260 aa AA seqDB search
MANDLPLQGKTVLVTRNKRQAAPFRKKVEALGGTAVSASLIAFQEALPGECADSLREDLS
EPGWLVFTSVNGVRFFFSYLDEHGLALSGRKKIAAVGEKTARALKERGAGTDAMPDEYVA
ECLADTLKRHASAAEPISVIKGNLSRDVIKAELEPLGYQIREWVLYNTIQDEKGMDELRQ
AASRSHFDFITFTSSSAVHTFMHAVGDEKKTLENSGASYISIGPLTEKALLEYGISSHVP
DTYTIEGMLDVMCSMSGKDR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgaccttcctttacaaggaaagaccgtgcttgtcacccggaacaaaagacag
gccgccccgttccgaaaaaaagtggaggcgctcggcggaacggctgtttccgcttcgctg
atcgcttttcaggaagcgctcccgggtgaatgtgcggacagtctccgggaagacctttct
gagccggggtggcttgtttttacaagcgtaaacggtgtccggttctttttttcctacctc
gatgagcacggccttgcgctttcgggacggaaaaaaatcgcagccgtcggtgaaaagact
gcgcgcgcccttaaagagcggggagccgggacggatgcgatgcctgatgagtatgtggct
gaatgtctggctgatacattaaagcggcacgcatcagctgccgaacccatttcagtgata
aagggcaatttatcacgcgatgtcataaaagcggagcttgagccgcttggctatcaaata
agggaatgggtgctgtacaataccattcaggatgaaaaaggaatggacgagctgagacag
gctgcatcccgctctcattttgattttattacgtttaccagttcttcggcggtgcatacg
tttatgcatgcggtcggagacgaaaaaaaaactttggaaaacagcggtgcgagctatatc
agcatcggccctttgacggaaaaagcgctattggaatacgggatctcatcccatgtgcct
gacacctatacgattgaaggcatgctggacgtcatgtgcagcatgtcgggaaaggataga
taa

DBGET integrated database retrieval system