KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_14345Help
Entry
BAMTA208_14345    CDS       T01824                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAMTA208_14345 (pfkA)
   01230 Biosynthesis of amino acids
    BAMTA208_14345 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMTA208_14345 (pfkA)
   00030 Pentose phosphate pathway
    BAMTA208_14345 (pfkA)
   00051 Fructose and mannose metabolism
    BAMTA208_14345 (pfkA)
   00052 Galactose metabolism
    BAMTA208_14345 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BAMTA208_14345 (pfkA)
Enzymes [BR:baz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BAMTA208_14345 (pfkA)
Protein phosphatases and associated proteins [BR:baz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BAMTA208_14345 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2740057..2741016)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMEEIIGRLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEPNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagtattaacgagcggcggggattccccggggatgaacgcagcggtg
cgcgcggttgtgcggaaagctatctaccacgatgtagaagtatacggaatttataacggt
tattcaggattaatcagcggaaaaatagagaaactggagctgggttcggtcggcgacatc
atccatcgcggaggaacaaagctgtacacggccagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggaatcgaaaatttaaagaaactcggcatcgaaggtcttgtcgttatc
ggcggagacggttcatacatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgtaccgggtacgatagataatgacatcccgggaactgattttacgatcggatttgat
acggcgttaaacaccgtaattgatgcgattgataaaatccgtgacaccgctacgtcgcat
gagcgtacatacgttattgaagttatggggcgccatgcaggcgacattgctttatgggca
gggcttgcaggcggagcggaatcaattttaattcctgaagcggattacgatatggaggaa
attatcggccgtttgaagagagggcatgaccgcggcaaaaaacacagtatcatcatcgtt
gcagaaggggtaggcagcggggttgaattcggaaaacgcatcgaagaagagacgaacctt
gaaacacgggtatccgttttagggcacatccagcgcggcggatctccaagcgcttctgac
cgggttcttgcaagccgcctcggcgcttacgcggttgagcttctgcttgaaggaaaaggc
ggacgctgcgtaggtatacaaaacaacaagcttgtagaccatgatattatagaaatttta
gagacaaaacatactgttgaaccaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system