KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_14600Help
Entry
BAMTA208_14600    CDS       T01824                                 

Gene name
acsA
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00010  Glycolysis / Gluconeogenesis
baz00620  Pyruvate metabolism
baz00640  Propanoate metabolism
baz00680  Methane metabolism
baz01100  Metabolic pathways
baz01110  Biosynthesis of secondary metabolites
baz01120  Microbial metabolism in diverse environments
baz01130  Biosynthesis of antibiotics
baz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMTA208_14600 (acsA)
   00620 Pyruvate metabolism
    BAMTA208_14600 (acsA)
   00640 Propanoate metabolism
    BAMTA208_14600 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BAMTA208_14600 (acsA)
Enzymes [BR:baz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BAMTA208_14600 (acsA)
Lipid biosynthesis proteins [BR:baz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BAMTA208_14600 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEB25081
Position
complement(2787436..2789154)
Genome map
AA seq 572 aa AA seqDB search
MNLKALPAEKGNYHLQNYEETYRSFDWKEAEAEFSWHQTGKLNAAYEAIDRHAESFRRNK
VALYYKDANREEKYTFKEMMEESNRAGNVLRRYGNVEKGDRVFIFMPRSPELYFIMLGAI
KIGAIAGPLFEAFMEGAVKDRLLNSQAKVVVTTPELAERIPAESLPDLQHIFIVGGSEET
GDKIIHYDKAAEGESTRLDIEWMDRRDGYLLHYTSGSTGTPKGVLHVHEAMIQQYQTGKW
VLDLKEDDIYWCTADPGWVTGTVYGIFAPWLNGAANVIVGGRFSPENWYGTIEKLGVSVW
YSAPTAFRMLMGAGDEMASKFDLTSLRHVLSVGEPLNPEVIKWGHKVFGKRIHDTWWMTE
TGGQLICNYPCMEIKPGSMGKPIPGVEAAIVDNQGNELPPYRMGNLAIKKGWPSMMDSIW
NNKEKYDSYFMPGGWYVSGDSAYMDEDGYFWFQGRVDDVIMTSGERVGPFEVESKLVEHP
AIAEAGVIGKPDPVRGEIIKAFIALREGHEPSDQLKEDIRLFVKQGLAAHAAPREIEFKD
KLPKTRSGKIMRRVLKAWELNLPAGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgaaagcgttgccagcagaaaaggggaattatcatctgcaaaattatgaggaa
acataccgcagcttcgattggaaagaagcagaggccgagttttcctggcatcagaccggg
aagctgaatgccgcatacgaagcgattgaccgccatgccgagtcatttcgcagaaacaaa
gtagcgctgtattacaaggacgcaaacagagaagaaaaatacacatttaaagaaatgatg
gaggaatcgaaccgggcgggaaatgtgctgagacggtatggaaacgtggaaaaaggagac
cgcgtttttattttcatgcctcgttcgccggagctgtattttatcatgctcggcgctatt
aaaatcggtgcgattgccggtcctttatttgaagcgtttatggaaggcgccgtcaaagac
cgtctgctgaacagccaggcaaaggttgtcgtgacaacacctgagctggccgaacggatt
ccggcagagagtctccccgacctgcagcatattttcattgtcggcggcagcgaagaaacg
ggagataaaatcatccattacgataaagcggctgaaggggaaagcacgagacttgacatt
gaatggatggacagaagagacggctacctgcttcattacacatcaggttctaccggaacg
cctaagggcgtgcttcacgttcatgaagccatgattcagcaataccagaccggcaagtgg
gtgcttgatctcaaagaagacgatatttactggtgcactgcggacccaggttgggtgacc
gggacggtgtacgggatttttgcgccgtggctgaacggagcggcgaacgtaatcgtcggc
ggcagattcagtccggaaaactggtacggcacaattgaaaagctcggtgtcagcgtctgg
tacagcgctccgaccgctttcagaatgcttatgggcgccggagatgaaatggcgtccaaa
tttgaccttacctcacttcgtcacgtcctgagtgtcggagagcctttaaaccctgaggtc
atcaagtgggggcataaagtattcggcaagcgcatccatgatacgtggtggatgacggaa
accggcggacagcttatctgcaattatccttgcatggagatcaagccgggttcaatgggg
aaaccgattccgggagtggaagcggcgatcgttgacaatcaaggaaatgaacttccgccg
taccggatggggaacctcgccattaaaaagggctggccgtccatgatggattccatttgg
aataacaaagaaaaatatgattcttatttcatgccgggcggctggtatgtttccggagat
tcagcttatatggatgaagacggttatttctggttccaaggcagagtcgatgatgttatt
atgacatccggcgagcgtgtcggcccgtttgaagtcgaaagcaaacttgttgaacatccg
gcgattgccgaagccggtgtcatcggaaagccggatcctgtccggggagaaatcattaaa
gcgtttatcgccctcagagaaggacatgaaccatccgatcagctgaaggaggacattcgc
ctctttgtaaaacaagggcttgccgcgcatgccgcaccgcgtgaaattgagttcaaagat
aaactgccgaaaacacgaagcggaaaaatcatgcgacgtgtcctgaaggcgtgggagctg
aacctgccggcaggcgacctgtccacaatggaagattaa

DBGET integrated database retrieval system