KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_14740Help
Entry
BAMTA208_14740    CDS       T01824                                 

Gene name
ytjP
Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAMTA208_14740 (ytjP)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BAMTA208_14740 (ytjP)
Enzymes [BR:baz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BAMTA208_14740 (ytjP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2814116..2815510)
Genome map
AA seq 464 aa AA seqDB search
MNWEVEVIRNKEDLIRDTQKFLQINSVMDESTAGPGRPFGEGVGDCLTSLLEFGEKEGFT
VKNLDGYAGHIEWGTGDEIVGVLCHVDVVPPGDGWTSDPFSADIRDGRIYARGAIDDKGP
TMAAFYALKIVKDMQLPLSKRVRIIIGTDEESDWRCVDHYFKHEKMPDVGFAPDADFPII
NAEKGIIDASLRIAKSASDKEDAKNGLLSFRSGLRLNMVPDAAEAVIEGDGLDAVHAYFS
NWLEQSKTQGEAVSENGKLTLRVYGKSCHAMEPDNGINAGLKLAECLERAELDEAGKHFV
KTVSDYFSNDTRGKKLKIDCRDDISGELTLNVGTFTYNKGEEGELGINIRYPVTSDSKVI
RDAFMSVEEFRLEEFKDSKPHHVSADHPLVKTLQNVYEGQTGKKADLISIGGGTYARSLS
AGVAFGPLFPDRPDSAHQKDEYIEIDDLLRSTALYAQAIYELAK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagttgaagtgatcagaaacaaagaagatctgattcgtgacacgcagaag
tttctgcaaatcaacagcgtaatggacgaatcaacagccggtcccggccggccgtttgga
gaaggcgtaggtgactgcctgacttcactgttggaattcggtgaaaaagaaggcttcacc
gtaaaaaatcttgacggctatgcgggccatattgagtgggggacgggtgacgaaatcgtc
ggtgttctgtgccacgtcgacgtcgttccgcccggagacggctggacgagcgatccgttt
tcagccgacatcagggatggccggatatatgccagaggtgccattgatgataaagggccg
acaatggcggcgttttacgcgctgaaaatcgtcaaagacatgcagctgcctttatccaaa
cgcgtgagaatcatcatcggaacggatgaagagagtgattggagatgtgtggaccactac
ttcaaacacgaaaaaatgcctgatgtcggatttgcccctgacgcagattttccgatcatt
aacgcagaaaaaggaattatagacgcatcactgcgcattgcaaaaagcgcttctgataaa
gaagacgcaaaaaacgggcttctgtcattccgttcaggactgcgcttgaacatggtgccg
gatgcggctgaagcggtcattgaaggggacggtcttgatgccgtacacgcctatttcagc
aactggctggagcaatcaaaaacacaaggtgaagcggtttcagaaaatggaaaactgacg
cttcgggtgtacgggaaatcatgccacgcaatggagccggataatggcataaatgccggc
ttaaagcttgctgaatgccttgagcgagcggaactggatgaggccggaaagcactttgtc
aaaactgtcagtgactatttttctaatgatacacgaggcaaaaagctgaaaattgattgc
agggatgacatcagcggagagcttacattgaatgtcggcacctttacatacaataagggt
gaggaaggggaactcggcatcaacattcgttaccctgtcacttcagacagcaaagtcatc
cgtgatgcctttatgtctgttgaagaattccggcttgaagaatttaaagacagcaaaccg
caccacgtatctgccgaccatccgctcgtaaagacgcttcagaacgtatacgaagggcag
acgggaaagaaagcggatctgatttcaatcggcggaggaacgtatgcgagatccctttcg
gctggcgtcgcattcgggccgctgtttcccgacaggcctgacagcgcgcatcaaaaggat
gagtacattgagattgatgaccttctccggtcaaccgccttatacgctcaagccatttat
gagcttgccaagtga

DBGET integrated database retrieval system