KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_14810Help
Entry
BAMTA208_14810    CDS       T01824                                 

Gene name
melA
Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:baz00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:baz00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:baz00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2829555..2830853
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDAVRLKESQLMLENMRDRYNTS
VSIISYDDRKQALKQAGYVINAIQVGGYKPATVIDFDIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEVCPDAWLLNYTNPMASLTGAMLRHTNVKTVGLCHSVQVCTKDLF
DSLGMDHEGTEERIAGINHMAWLLEIKKDGIDLYPEIKRRAREKQKTKHNDMVRFELMDK
FGCYVTESSEHNAEYHPYFIKSRYPELIDELQIPLDEYPRRCAEQIKNWETIRDGIINNQ
NLTHERSNEYGSRIIEAMETGRPFMFGGNVLNTGLIPNLPAKAVVEVPCAAVKNQIMPCY
SGELPEQLAALNRTNINTQLLTIEAAVTLKKEAVYQAAMLDPHTSAELSMNDIISLCDDL
FEAHKDWLPAYH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaattacgtttatcggagcgggaagcacgatatttgcgaaaaatgtactggga
gactgtttactgactgaagctttaaacggatttgaattcgcgctttatgatattgatgct
gtacggctgaaagaatcccagctcatgctggaaaacatgagagaccgctataatacgagc
gtatccatcatttcttacgatgaccgaaaacaggcgctaaaacaggccggctatgtgata
aacgccattcaggtcggcggttataaacccgcgacggtcattgactttgacatccctaag
cggtacggcctgcgccagacgattgccgataccgtcggaataggcggcattttccgttcc
cttcgcaccatccccgttttatttgacatcgctaaagacatggaagaggtctgtccggat
gcgtggctgttaaactatacaaatccgatggcttctctgaccggcgcgatgctcagacat
acaaatgtaaaaacggtcggcctgtgccacagcgtacaggtctgtacaaaagatctgttt
gactcactcggcatggatcacgaaggtacggaagaacgcattgccggcatcaatcacatg
gcttggctcttagagatcaaaaaagacggaattgatttgtatccggaaattaaaagacgc
gcccgcgagaaacaaaagacgaaacataatgacatggtgcggtttgagctgatggataag
ttcggctgctacgtaacggaatcatctgagcacaatgccgaatatcacccgtattttata
aaaagccggtatccggagctgatagatgaactccagatcccgctagatgaatatccgaga
agatgcgcagaacaaatcaaaaactgggaaacgataagagacggcatcatcaacaatcaa
aacctgacgcatgagcgctcgaatgaatacggttcgagaattatagaagcgatggagacg
ggccgtccgtttatgttcggcggcaatgtgctgaatacgggactcataccgaatctgccg
gcgaaagcagtcgttgaagtgccttgcgcagccgttaaaaatcaaattatgccttgctat
tcaggcgaacttccggaacagctcgcggcgcttaacagaacaaacattaatacacagctt
ttaaccatcgaagcggccgttactttaaaaaaggaagccgtatatcaggcggccatgctt
gatccgcatacgagcgccgagctttccatgaatgacatcatctctttgtgcgatgattta
tttgaagcccataaagactggcttccggcgtatcactga

DBGET integrated database retrieval system