KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_14945Help
Entry
BAMTA208_14945    CDS       T01824                                 

Gene name
ytpA
Definition
phospholipase component of bacilysocin synthesis or export
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAMTA208_14945 (ytpA)
Enzymes [BR:baz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BAMTA208_14945 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2853168..2853947)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVGTIVIIHGASEYHGRYKWLVEMWRSSGYNVVMGDLPGQGTSTRARGHIRS
FQEYIDEVDIWIDQARTLESPVFLLGHSMGGLIAIEWFKQQRNPRITALILSSPCLGLQI
KVNKVLDFASKGLNVLAPSLRVDSGLSPDMATRNADMIEADQNDSLYVTKVSVRWYRELL
KTIDAAMVPTDAFLKVPLLLMQGGDDKIVDKMKVRKWFSGVASHNKSYREWEGLYHEIFN
EPEREAVFKAAKAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacttggaaagcagacaggcccgtcggtaccattgtcataatccacggggcaagc
gaataccacgggcgttataaatggctcgttgaaatgtggagatcttccggatataacgtg
gtgatgggtgatttgcccggtcagggaacatccacccgcgccagagggcatattcgctct
ttccaagaatacattgatgaagtagatatatggattgatcaagcgagaacgcttgaatcg
cccgttttccttttgggccacagcatgggcggactgattgcgatagaatggtttaagcag
cagagaaatccccgcattacggcactcattttatcatcaccttgtcttgggctgcaaata
aaagtcaataaagtgcttgattttgcgtctaaaggactgaatgttctcgccccgtccctc
agagtggactccggtttatcgcctgatatggcgacaaggaatgcggatatgattgaagcg
gatcaaaacgattctttatatgtcacgaaagtatctgtaagatggtacagagagctttta
aaaaccattgatgccgctatggtgccgactgatgcgtttttaaaagtgccgcttttgctt
atgcagggcggtgatgacaaaatcgttgataaaatgaaggtccgtaaatggttttccggt
gtggcttcccataataaatcataccgggaatgggaagggctttatcatgaaatttttaat
gaaccggaaagagaagctgtgtttaaggcggcgaaagcctttacagatcagtatatttga

DBGET integrated database retrieval system