KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_17085Help
Entry
BAMTA208_17085    CDS       T01824                                 

Gene name
yvaK
Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
baz  Bacillus amyloliquefaciens TA208
Brite
Enzymes [BR:baz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BAMTA208_17085 (yvaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S9 DLH Abhydrolase_6 DUF2048 BAAT_C UPF0227 ABC_tran_Xtn Tubulin_3
Motif
Other DBs
NCBI-ProteinID: AEB25569
Position
complement(3241478..3242218)
Genome map
AA seq 246 aa AA seqDB search
MKIVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYKGHGVPPEEL
VHTGPKDWWKDVMDGYEYLRSEGYENIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEEVMYEGVLSYARNYKKFEGKQPEQIEKEMKEFEKTPMNTLKSLQELIADVRKNVDMI
YSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEF
LEKLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttctg
ctgcacggatttacgggaaatacggcagatgtcagaatgcttggccgctacttgaatgag
cgcggctacacttgccacgcgcctcaatataaagggcacggcgttccgccggaagagctg
gtacatacgggaccaaaagattggtggaaagacgtcatggacggttatgagtatttacgg
tctgaaggctatgaaaacattgcggcctgcggactgtcgcttggcggggttttttcattg
aaattgggttacactgtacccataaagggaattgtacctatgtgtgcgccaatgcacatt
aaaagtgaagaggttatgtacgaaggagttctctcctacgcgcgcaattataagaaattc
gaaggaaaacagccggagcagattgaaaaagaaatgaaggagtttgaaaaaacgccgatg
aatacgctcaaatcgcttcaggagctgattgccgatgtgcgcaaaaacgtcgacatgatc
tattccccgacatttgtggttcaggcacggcatgaccatatgattaatacagaaagtgca
aacatcatttacaacgaggtggaaacggacgacaaacagctgaaatggtatgaagagtca
ggacatgtcattacgctggacaaagaacgggacctcgttcatcaggatgtgtacgaattt
ttagagaaactcgattggtaa

DBGET integrated database retrieval system