KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_17085Help
Entry
BAMTA208_17085    CDS       T01824                                 

Gene name
yvaK
Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
baz  Bacillus amyloliquefaciens TA208
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3241478..3242218)
Genome map
AA seq 246 aa AA seqDB search
MKIVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYKGHGVPPEEL
VHTGPKDWWKDVMDGYEYLRSEGYENIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEEVMYEGVLSYARNYKKFEGKQPEQIEKEMKEFEKTPMNTLKSLQELIADVRKNVDMI
YSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEF
LEKLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttctg
ctgcacggatttacgggaaatacggcagatgtcagaatgcttggccgctacttgaatgag
cgcggctacacttgccacgcgcctcaatataaagggcacggcgttccgccggaagagctg
gtacatacgggaccaaaagattggtggaaagacgtcatggacggttatgagtatttacgg
tctgaaggctatgaaaacattgcggcctgcggactgtcgcttggcggggttttttcattg
aaattgggttacactgtacccataaagggaattgtacctatgtgtgcgccaatgcacatt
aaaagtgaagaggttatgtacgaaggagttctctcctacgcgcgcaattataagaaattc
gaaggaaaacagccggagcagattgaaaaagaaatgaaggagtttgaaaaaacgccgatg
aatacgctcaaatcgcttcaggagctgattgccgatgtgcgcaaaaacgtcgacatgatc
tattccccgacatttgtggttcaggcacggcatgaccatatgattaatacagaaagtgca
aacatcatttacaacgaggtggaaacggacgacaaacagctgaaatggtatgaagagtca
ggacatgtcattacgctggacaaagaacgggacctcgttcatcaggatgtgtacgaattt
ttagagaaactcgattggtaa

DBGET integrated database retrieval system