KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_19820Help
Entry
BAMTA208_19820    CDS       T01824                                 

Gene name
bglH
Definition
aryl-phospho-beta-d-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:baz00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3766853..3768250)
Genome map
AA seq 465 aa AA seqDB search
MKRFPEGFLWGGATAANQIEGAYKEGGKGLSTADVSPDGIMSPFHETDDALNLYHDAIDF
YHRYQEDIALFAEMGFKAFRTSIAWTRIFPNGDETEPNEEGLQFYDRLFDELRKHQIEPV
VTISHYEMPLGLVKNYGGWRNRQTVDFYERYARTVFTRYKDKVKYWMTFNEINVVLHAPF
TGGGLVFREGENKQNTMYQAAHHQFVASALAVKAGHEIIPDSQIGCMIAATTTYPMTPKP
EDVYAALQKERSTLFFSDVQARGSYPGYMKRFFKETGITIEMKEGDEELLKEHTVDYIGF
SYYMSMTASTAPEDLAQSKGNLLGGVKNPYLESSEWGWQIDPKGLRITLNTLYDRYQKPL
FIVENGLGAQDQPEEDGSIQDDYRIKYLRDHLIEAREAIEDGVNLIGYTSWGPIDLVSAS
TAEMKKRYGYIYVDRGNDGTGTFERKRKKSFYWYKDVIATNGESL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatttccggaaggttttttatggggcggcgcaacggctgccaatcagattgaa
ggagcttacaaagaaggcggcaaaggactttccacggcggatgtctccccggacggcatt
atgtcaccgttccatgagacagacgatgcgctgaatctgtatcacgacgcgattgatttt
tatcaccgctatcaagaggacatcgctctgtttgcggagatgggctttaaagcgttccgc
acctccattgcgtggacgagaatctttccgaacggcgatgaaacagagccgaatgaagaa
gggctgcaattttacgaccgtctttttgatgaattgagaaaacatcagatcgaaccggtg
gtcacgatttcgcactacgagatgccgctcggtctggtgaaaaattacggcggctggaga
aaccgccaaacggtcgatttctatgagaggtacgcccgcacggttttcacccgttataaa
gacaaggtgaaatattggatgacattcaatgaaatcaatgtcgttcttcacgctccgttt
acaggcggcggtctcgtattccgggaaggcgaaaataaacaaaacacgatgtaccaagcg
gcccaccaccagtttgtggcgagcgcgctggcggtaaaagccggccatgagatcatcccg
gattcacagatcggctgcatgatcgccgcgacgacgacgtatccgatgacgccgaagccg
gaggatgtatatgcggctttgcagaaagagcggagcacgctgttcttttctgatgtgcag
gcgaggggcagctatccgggctacatgaagcgcttctttaaagaaaccggaattacgatt
gagatgaaggaaggagacgaggagctcctgaaagaacacacggtggattacatcggcttc
agctactacatgtcgatgacggcaagcaccgcgcctgaggatctggcgcaatcgaagggg
aatcttctcggcggcgtgaaaaatccttatctggaatcttcggaatggggctggcagatt
gatccgaagggcttgcgcattaccttaaacacgctgtacgaccgttatcagaaaccgctc
ttcatcgtcgaaaacgggctcggcgcacaagatcagccggaggaagacggaagcatacag
gatgattaccgtatcaaatatctgcgggatcatttaatagaagcaagagaggcgatcgaa
gacggagtcaacctgatcggttacacgtcgtgggggccgattgacctcgtcagcgcctca
actgctgaaatgaaaaaacgctacggctatatctatgttgaccgcggcaatgacggaaca
ggcacgtttgaaaggaagagaaagaaaagtttttattggtataaagacgtcatcgcgaca
aatggagaaagtctgtaa

DBGET integrated database retrieval system