KEGG   Bdellovibrio bacteriovorus HD100: Bd0129Help
Entry
Bd0129            CDS       T00159                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00300  Lysine biosynthesis
bba01100  Metabolic pathways
bba01120  Microbial metabolism in diverse environments
bba01230  Biosynthesis of amino acids
Module
bba_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bd0129 (dapE)
Enzymes [BR:bba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Bd0129 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CAE77800
UniProt: Q6MRF8
Position
112926..114272
Genome map
AA seq 448 aa AA seqDB search
MDFIEACRQLIAIDSSPTHGNKELSKWVAAFCRQRGLHVEEQEEVVGDLEQANVIARPVA
ERPEAEFLLQTHLDTVDPGPFSLWTDTGSNPFDAHIIDGKIHGLGAADVKLDFLCKLEAL
ASFGPDRKWRLPPVLVGTFGEESGMQGALKLIRKNKISAKMALIGEPSDLRVINAAKGFA
SVEIHVPFSDEEMRYREEHNLRESTSTQSKIFRGKAAHSSTPHLGESAIAKMFEYLMMLP
DSVNVMEMDGGINFNTVPSHAFLEIDMVNQIPEPISRKIANIYRAVKALELEFLDHKDDD
FYPTTPTLNIGLIRTNEGDIQISGSCRIPPVITHEIYEGWMDRLRQVCEANGATFRVNDY
KKPFRTEVTSILAKGCLDELRAMGLDDKPITQASTNEASIFTRVGIECVCFGPGKREGNV
HTPQEHVSIEDLHKAIEFYKRIIERFCL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttggacttcatcgaggcctgccgacaactgatcgctatcgacagctcacccactcacggc
aataaagaattgtccaagtgggtggcggccttttgccgtcagcgtggattgcacgttgaa
gagcaagaggaggttgtcggggaccttgaacaggcgaatgtgattgcccgtccggtggcg
gagcgcccggaagccgagttcctgctgcaaacgcatctggacacggtggatccggggccg
ttctcgctttggacagatacgggcagcaatccgtttgatgcccatatcatcgacggaaaa
atccacggcctgggggccgcggatgtaaagctcgacttcttgtgcaaactagaagcgctg
gcatcgttcggacctgatcgcaaatggcgtttgccgccagtcctggtggggacctttggg
gaagagtccggcatgcaaggggccctgaagctgattcgcaaaaacaagatttctgcgaag
atggcgttgatcggggagcccagtgatctgcgagtgatcaatgcggcgaaaggttttgcc
agtgttgaaattcacgtgccgttctcggatgaagagatgcgctatcgggaagaacacaac
ctgcgcgaaagcacctcgacgcagtctaagattttccgcggtaaagcggcgcactcttcc
acgccgcatctgggggaaagtgcgatagccaagatgtttgaatatctcatgatgctgccg
gattcggtgaacgtcatggagatggatggcggaatcaatttcaacactgttcccagccat
gcattcttggaaatcgatatggtgaaccagatccctgagcccatttcacgtaagattgcc
aatatctatcgtgcggtgaaagctctggagctggagtttttggatcataaagatgacgat
ttttatccgaccacgccgacattgaacattggactgatccgcaccaatgaaggcgacatt
cagatttccggttcgtgccggattcctccggtgatcacgcatgaaatctatgaaggctgg
atggatcgtctgcgccaggtgtgcgaagccaatggcgccaccttccgcgtgaatgactat
aaaaagcccttccgcaccgaagtgacttcgattcttgcaaaagggtgtctggatgaattg
cgggcgatgggacttgatgacaagccaatcacccaggcctcaacaaatgaagccagcatc
ttcacccgcgtgggtattgagtgtgtgtgttttggtcccggtaaaagggaaggaaacgtg
cacacccctcaggagcacgtctctatagaggatctgcacaaggctattgagttttataaa
aggatcatcgaaaggttttgtttatga

DBGET integrated database retrieval system