KEGG   Bdellovibrio bacteriovorus HD100: Bd0142Help
Entry
Bd0142            CDS       T00159                                 

Gene name
dfrA
Definition
(GenBank) dihydroflavonol-4-reductase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bba  Bdellovibrio bacteriovorus HD100
Brite
Enzymes [BR:bba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Bd0142 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 NAD_binding_10 GDP_Man_Dehyd RmlD_sub_bind NmrA Polysacc_synt_2 KR adh_short TrkA_N
Motif
Other DBs
NCBI-ProteinID: CAE77813
UniProt: Q6MRE5
Position
complement(126649..127641)
Genome map
AA seq 330 aa AA seqDB search
MKKVLVTGANGFLGSWLTKALLEEGHDVYALVRPKSDLSELEGVKCKYVHGDVTDVHSLL
EATKGMDTVFHLAGVIAYKKSQRALMDKVNVEGTANVIAVCREHNVRRLVYLSSVVAIGA
GYTPDQILNEESPYNIADLNLGYFETKHQAETLVKSACDKNEIDAVMLNPSTIYGRGDAK
KGSRKMQVKVAQGKLNFYTSGGVNVVAAEDVVAGILSAWKVGRKGERYILSGENILIKDL
FAMIAAEAGVKPPKHQLPDGLLHAVGAVGDFMEKIGMKGPLSRENAYTATMYHWFDSSKA
QKELGFTPRPAREAIHNSVQWMKDHGLVAK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagttttagtcaccggagcaaacggttttttaggcagctggctgaccaaagcc
cttctggaagagggccacgatgtctatgccctggttcgccctaaaagtgacctttctgaa
ctggaaggcgtgaagtgcaaatacgttcacggcgatgtcactgatgtacattccttgctg
gaagccaccaaaggcatggacacggtctttcacctggccggagtgattgcctataaaaag
tcccaacgcgccctgatggacaaggttaatgtcgaaggcacggccaacgtcattgctgtc
tgccgcgagcacaacgtgcgacgtttggtttacttgtcctcagtggtggccatcggggcc
ggatacacccccgatcagattctgaatgaagaatccccttacaacatcgcggatctgaat
ctgggatacttcgaaaccaaacaccaagccgaaactctggtaaaaagcgcctgcgacaaa
aatgagatcgacgccgtgatgctgaacccctcgacaatctatggccgaggagatgccaaa
aagggcagccgcaagatgcaggtcaaagttgctcaagggaaattgaatttctacacctct
ggcggcgtgaatgtagtcgctgcggaggatgtcgttgccggcattctgagcgcctggaag
gtcggacgcaaaggcgaacgctatattctttccggcgaaaacattctgatcaaggatctc
tttgcgatgattgcagccgaagccggcgtcaaacctccgaagcaccagctgcctgacggc
cttttgcatgccgtcggcgctgtcggtgacttcatggaaaagatcggcatgaaaggacca
ctgagccgcgagaatgcctacacggccacgatgtatcattggtttgattcttccaaagcc
caaaaggaacttggcttcacaccaagaccggcccgcgaagccattcacaattctgtgcaa
tggatgaaagatcacggactggtggcaaagtag

DBGET integrated database retrieval system