KEGG   Bdellovibrio bacteriovorus HD100: Bd0146Help
Entry
Bd0146            CDS       T00159                                 

Gene name
bglX2
Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bd0146 (bglX2)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Bd0146 (bglX2)
Enzymes [BR:bba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bd0146 (bglX2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(129832..130944)
Genome map
AA seq 370 aa AA seqDB search
MSISHIIGQHMFIGVSGHALTADEKKFIVENNIGGVCLFGRNVAEPKQVRELCAEIQSLR
HKQVDKAPLFIGIDMEGGRVHRLKAPFTVWPPLRKLGDLDAPTVSFHFANRMGLEMKAVG
INLDFAPCVDIFTNPGNTVIGDRSISSDPEMVAKHASALVRGYIKSDVITCAKHFPGHGN
TIVDSHEDLPVENTDLERLESCELIPFKKTFKSRVDMVMTSHIKFPKIDPEWPVTLSETF
VRKMIREEMRYRGLIITDDLGMKAMTKHYGIEEVPVRALKAGVDLLLYCNDPEVPPQAYD
AILGALAQGSLKKEDLEASYHRIMDFKKVKIQNPDPLPLEEAIKIIGSPEHLKIASAIAN
GQIPDGLLSE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcagtcatatcatcggtcagcacatgttcatcggcgtatcaggtcacgccctc
accgctgacgaaaagaagttcattgtagaaaataatattggtggtgtgtgcctgtttggc
cggaacgtcgctgaacccaaacaagtgcgcgagctgtgcgccgagatccagtccctgcgc
cacaaacaagtcgacaaggctccgctgtttattggtatcgacatggaagggggccgtgtt
caccgcctgaaggccccgttcaccgtgtggccacctctcagaaaactgggcgacctggat
gctccgaccgtgtccttccactttgccaaccgcatgggtcttgaaatgaaagccgtgggc
atcaatctggattttgccccttgtgtggatatcttcaccaatcccggcaacaccgtcatt
ggcgaccgttccatcagttctgatcccgagatggtggcaaaacacgcttctgccctggtt
cgcggatacatcaaatccgatgtcatcacttgtgcgaagcacttcccaggacatggaaac
accatcgtcgacagccacgaagacctgccggttgaaaacactgatctggagcgcctggag
tcctgcgagctgattccgtttaaaaagaccttcaaatcccgcgtggacatggtcatgacc
tcgcacatcaagtttccgaaaattgatcctgaatggccggtgactttgtccgagacattc
gtaagaaaaatgattcgtgaagagatgcgctatcgtggcctgatcatcaccgatgatctg
ggtatgaaagccatgaccaaacactatggcattgaagaggttcccgtgcgggccctgaag
gccggtgtggatctgctgctttattgtaacgatccagaagttccgccgcaggcttacgac
gccattctgggtgcattggcgcaagggtccctgaagaaagaggatcttgaagccagctat
catcgcatcatggactttaaaaaagtaaagattcagaatcctgacccgctgccattggaa
gaagcaatcaagatcatcggcagtccggaacacctgaagatcgcctccgcgatcgccaat
ggccagattcccgacgggcttttgtcagagtaa

DBGET integrated database retrieval system