KEGG   Bdellovibrio bacteriovorus HD100: Bd0326Help
Entry
Bd0326            CDS       T00159                                 

Gene name
btuE
Definition
(GenBank) putative vitamin B12 transport protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00480  Glutathione metabolism
bba00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bd0326 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bd0326 (btuE)
Enzymes [BR:bba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bd0326 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CAE77982
UniProt: Q6MQX6
Position
complement(309996..310544)
Genome map
AA seq 182 aa AA seqDB search
MSTLNHIEFNTADGKKATLADYSGKVLLVVNVASECGLTPQYEGLEKIHQKYESQGLRVL
AFPANEFGAQEPGSNEQIQEFCRTQFGVKFPVFAKMVVKGEGQHPLYQQLTTLQPAAQQV
PGGKLKSVLEEHGLLSGGPSDIMWNFEKFLIGKSGNVVARFAPDMTPEDPTIVKAIEAEL
AR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcttaatcacatcgaattcaacacggcagatggtaaaaaggcgactttggct
gactatagcggcaaagttcttttggttgtgaacgtggcttctgaatgcggactgacccca
cagtatgagggtcttgaaaaaattcatcaaaaatacgaatcccagggactgcgcgttctg
gccttcccggccaacgagttcggcgctcaagagcccggctccaacgaacagatccaggaa
ttctgccgcactcaattcggtgtgaagttcccggtgtttgcaaaaatggttgttaaaggt
gaaggccaacatccactgtatcaacaactgacgactctgcagccggcagcacaacaggtt
ccgggcggcaaactgaaatctgttctggaagagcacggccttctgtctggcggtccttcc
gacatcatgtggaactttgaaaagttcctgatcggcaaatccggcaacgtggtggcacgt
tttgctcctgacatgactccggaagatcccacaatcgtaaaagcgattgaagctgagctg
gctcgctag

DBGET integrated database retrieval system