KEGG   Bdellovibrio bacteriovorus HD100: Bd0340Help
Entry
Bd0340            CDS       T00159                                 

Definition
(GenBank) lipase/acylhydrolase domain protein
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bd0340
Enzymes [BR:bba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bd0340
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Bd0340
Lipid biosynthesis proteins [BR:bba01004]
 Fatty acid synthase
  Component type
   Bd0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL Lipase_GDSL_3 OSK
Motif
Other DBs
NCBI-ProteinID: CAE77995
UniProt: Q6MQW3
Position
322819..323418
Genome map
AA seq 199 aa AA seqDB search
MRPFLFSLILLFSSFSFAQKKLIVLGDSLTEGYGVAKEAAFPAVLEKKLHEAGKKEWTII
NAGVSGSTTASGLSRMKWVFKSKPDVVLLALGANDGLRGLKVEDSEKHLAQSIEYAQSQK
VKVILGGLYMPPNYGKDYTDKFKKMYESLAKKYKLTFIPFILDKVAGNPKYNLADGIHPN
EEGHKIIADNVFSVLKGAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagaccttttttattttcactcattcttctttttagttctttttcgtttgcccaaaaa
aaactgatcgttctgggtgattcgctcaccgaaggatatggcgttgccaaagaggccgcg
ttccccgcggtcctggaaaagaaacttcacgaggccggcaagaaggaatggaccatcatc
aatgccggggtcagtggttccaccacagcgtcggggcttagccgcatgaagtgggtgttt
aaatcaaagcctgatgttgtgcttttggccttgggggccaacgatggtttgcgcggtttg
aaagtcgaagacagcgaaaaacatctggctcagtccatcgaatacgcacaatcccaaaaa
gtaaaagtcattctgggtggtttgtacatgccaccgaactacggcaaggactacaccgac
aaattcaaaaaaatgtacgagtcgctggccaagaaatacaagctgaccttcattccattc
atcctggacaaggtggcgggaaatccaaaatacaatctggccgacgggattcatcccaac
gaagaaggtcataaaattatcgcagacaatgtgttttcagttctaaagggggcgttgtga

DBGET integrated database retrieval system