KEGG   Bdellovibrio bacteriovorus HD100: Bd0356Help
Entry
Bd0356            CDS       T00159                                 

Definition
(GenBank) putative arginase (Fragment)
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00330  Arginine and proline metabolism
bba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bd0356
Enzymes [BR:bba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Bd0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: CAE78008
UniProt: Q6MQV0
Position
complement(332962..334017)
Genome map
AA seq 351 aa AA seqDB search
MSEKTVKFDPTTTISAEFGIFGIPMTEEESKVVLVPVPWEVTTSYGEGASRGPQIIRQAS
EQIDLFDIEVGKAYEVGYHMRDFPQDLCNMNDKFKAVAQELIGMRTNMSEDEAKMNKLAS
QVNEACEEMTQWVYDQCSDVLKKGKLLGLVGGDHSTPLGAIRAVSDKFKGEFGVLHIDAH
ADLRTAYQGFKQSHASIMYNVMTDAKKPQKLVQVGIRDFCEEEYDFSNSREDIKTFYDLE
LKRRMLKGETWEQVCKDIIKELPQNVYISFDIDGLDPAFCPHTGTPVPGGLSVDQVFFLF
REVHASGRKIVAFDLNEVSTGGLPEGEVEWDGNVGARILYKMCGWLVKSNA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaagactgtgaaattcgacccgacgaccaccatttctgcagagttcggaatc
ttcggaattcccatgaccgaggaagagtccaaggtcgttcttgttccagttccctgggaa
gtaaccacctcttatggcgagggcgcctcgcgcgggcctcagatcatccgccaagccagt
gaacagattgacctttttgacatcgaagtgggcaaagcctacgaagtcggctatcacatg
cgcgacttcccgcaagacctgtgcaacatgaacgacaagttcaaagccgtggctcaagag
ctgatcggaatgcgcaccaatatgagcgaagacgaagccaaaatgaacaagctggcttcc
caggtgaatgaagcctgcgaagagatgacccaatgggtttacgaccagtgctctgacgtc
ctgaaaaagggcaagctgctgggtctggttggtggcgatcactccaccccgcttggagcc
atccgcgcagtcagcgataaattcaaaggcgagttcggcgttttgcacattgatgctcac
gcggatctgcgcacggcttaccagggcttcaaacaatcccacgcttccatcatgtacaac
gtgatgactgatgctaaaaagcctcaaaagctggttcaagtcggcatccgtgacttctgc
gaggaagaatacgacttcagcaactcccgtgaagacatcaagaccttctacgacctggaa
ctgaaacgccgtatgctgaaaggcgaaacctgggaacaagtctgcaaagacatcatcaaa
gagcttccgcagaacgtttacatctcttttgatatcgatggtctggatccagccttctgc
cctcacaccggcacacctgttccgggcggcttgagcgtggatcaggtcttcttcctgttc
cgcgaagtgcatgcttccggtcgtaagatcgtggcttttgacctgaacgaagtttccact
ggcggcttgccagagggcgaagtcgaatgggacggcaacgtgggcgcgcgtattttgtat
aaaatgtgcggctggctggtgaagagcaatgcttaa

DBGET integrated database retrieval system