KEGG   Bdellovibrio bacteriovorus HD100: Bd0404Help
Entry
Bd0404            CDS       T00159                                 

Gene name
atoB
Definition
(GenBank) InterPro: Thiolase, mitochondrial 3-oxoacyl-Coenzyme A thiolase; hypothetical protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bd0404 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    Bd0404 (atoB)
   00640 Propanoate metabolism
    Bd0404 (atoB)
   00650 Butanoate metabolism
    Bd0404 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    Bd0404 (atoB)
   00072 Synthesis and degradation of ketone bodies
    Bd0404 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bd0404 (atoB)
   00310 Lysine degradation
    Bd0404 (atoB)
   00380 Tryptophan metabolism
    Bd0404 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bd0404 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bd0404 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bd0404 (atoB)
Enzymes [BR:bba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bd0404 (atoB)
Exosome [BR:bba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bd0404 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
380675..381856
Genome map
AA seq 393 aa AA seqDB search
MEKIVFISGKRTPFGAFGGSLKDVSATDLGVAAAKATLEQAGLSADKIDHVVFGNVVQSG
ADAAYLPRHIGLKTGVPVAVGAFAVNRLCGSGFQSWVNAVQMIQCGEATAVLAGGVEQMS
QIPYVARKVRFDGMRMGNFELEDLMTSALTDAYAKMPMAITAENLAVKYGITREESDKYS
IQSQQRFQAAVEKGFMKQEICLVTVEGRKGTVVIEKDEHPKPDSTLEKLATLKPVFKKDG
IVTAAAASGIVDGAACSLLMSESKAKELGMKPMARIVSYASVGCDPTIMGIGPAGAARLA
LQKAGLTLDQMDLVEVNEAFAAQYLAVEKELKLDPAKTNVNGGAIAVGHPLGASGTRIMN
HLVYELHRRNAKYALGSACIGGGQGIAIIIERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatcgtatttatctctggaaaaagaactcccttcggagccttcggcggttca
ttgaaggatgtatcagcaacggatctgggtgtcgctgccgctaaagcgaccctggagcaa
gccggtctgtctgcagacaagattgatcacgtggtgtttggcaacgtggttcagtccggt
gcggatgcagcctatcttccaagacatattggtttgaaaaccggagtgccggtcgcggtg
ggcgcttttgcggtcaaccgtctgtgtggcagtggtttccagtcctgggtgaatgccgtg
cagatgatccagtgtggggaagccaccgcggttcttgccggtggtgtcgagcaaatgtcc
cagattccttatgtggcccgcaaagtccgctttgatggcatgcgcatggggaacttcgaa
ctggaagatctgatgacctcggcgctgacggacgcttatgccaagatgcctatggcgatc
acggctgaaaatctggcggtgaaatacggtatcacgcgcgaagaatctgacaagtattcc
atccagtcccagcagcgcttccaggccgcggttgaaaaaggtttcatgaaacaggaaatc
tgcctggtcacagttgagggtcgcaagggcaccgtggtgattgaaaaagacgaacatcca
aaaccggattccactctggaaaaactggcgacgctaaagcctgtcttcaaaaaagacggg
attgtaacggcggcggcggcttccggtattgtcgacggggcggcttgttctttgttgatg
agcgaatccaaagccaaggaactgggcatgaaaccaatggcgcgtatcgtgagctacgct
tctgtgggttgtgacccgacgatcatgggtattggtccagcgggcgcagctcgtctggca
ttacagaaagccggactgactctggatcagatggatctggtggaagtgaacgaagctttt
gcggcccagtacctggcggtggaaaaagaattgaaactggatccggcaaaaaccaatgtg
aacggtggtgcgattgctgtcggtcaccccttgggtgcctccggcacccgcattatgaat
cacctggtgtatgagcttcatcgccgcaacgccaagtacgctctgggttctgcttgtatt
ggcggcggtcagggtattgcgatcatcatcgaaagaatctaa

DBGET integrated database retrieval system