KEGG   Bdellovibrio bacteriovorus HD100: Bd0504Help
Entry
Bd0504            CDS       T00159                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00010  Glycolysis / Gluconeogenesis
bba00620  Pyruvate metabolism
bba00640  Propanoate metabolism
bba00680  Methane metabolism
bba01100  Metabolic pathways
bba01110  Biosynthesis of secondary metabolites
bba01120  Microbial metabolism in diverse environments
bba01130  Biosynthesis of antibiotics
bba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bd0504
   00620 Pyruvate metabolism
    Bd0504
   00640 Propanoate metabolism
    Bd0504
  Energy metabolism
   00680 Methane metabolism
    Bd0504
Enzymes [BR:bba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bd0504
Lipid biosynthesis proteins [BR:bba01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bd0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAE78483
UniProt: Q6MQG4
Position
472903..474591
Genome map
AA seq 562 aa AA seqDB search
MSFRNEFEQARDFLILHRSDYKHAYSQFRWPRFDDFNWALDYFDPMAEGNTKIGLWLVDE
LGHEKKFSFSEISKRSNQAANFMRARGLQKGDSVFLLIEDDVALWEIMLAAMKLGAVIVP
NNPLLSQQELKDRLNREQIKMIATTKAHTEKFDVTSSGVIPVVVDAEVEGWIFYPEAYKE
SAEFEATERTKATDPLFRYFTSSSGVKPKLVEHSHAGFTVGHLSTMYWMGLHPGDVHLGI
NSAGWAMHDWNSFVAPWNAEATVFVFKEKRFNASLILDVLDEYPITTFCAPPTVWRLLCQ
EDLRSYDVHLREALSTGEPLTADLISKVHHAWGLFIRDGYGQTESATLIGVPPEEKDSFG
TSGKAMPGFKIALLDAQGEETDSGEICVDISESPWGLMSGLDTSNKYFHTGDTAYLDSMG
NFTYCDRIDGLFKSSDYRISPFEIEFVLKEFPSIREAVVIPSPDPIRENVPKALVMLSKG
VEPSKELALDIMNFARMRLSPFKRIRRVEFMEIPKNTSGEVLRSDLVNLEREKRKRGEKA
PYEFWEEDAKIVIPDTWAQELP
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagttttcgtaatgaatttgagcaggcgagggattttctgattctgcaccgttcagac
tataaacatgcttacagccaattccgctggccccgttttgatgatttcaactgggctctg
gattatttcgaccccatggccgaaggcaataccaagatcggtctgtggctggtggatgag
ctgggacatgaaaagaagttcagcttcagcgaaatctccaaacgttccaatcaggcggcg
aactttatgcgcgcccggggattgcaaaaaggcgactctgtctttctgctgatcgaagat
gacgtggccctttgggaaatcatgctggcggccatgaagctcggtgcggtgatcgttccg
aacaatcctttgttgtcccagcaggagctgaaagaccgcttgaaccgcgagcagatcaag
atgatcgccacaaccaaagcacacacagaaaaatttgatgtgacctcttcgggggttatc
cctgtggtggtggatgccgaagtcgagggctggattttttatccggaagcgtacaaggaa
agtgcagagttcgaagccactgagcggaccaaggccacggatcccctgttccggtacttt
acttcttccagcggggtgaaaccaaaacttgtcgagcacagtcatgccggatttacggtc
gggcatctttccaccatgtactggatgggactgcatcccggggacgtgcatctgggaatc
aactctgccggctgggccatgcatgactggaactcttttgtcgcaccttggaatgccgag
gcgacggtttttgttttcaaggaaaagcgtttcaacgccagtttgattttggatgttctg
gatgaatatcccatcaccaccttctgtgcgccgccgacggtgtggcgtttgttgtgccag
gaagatcttagatcctatgacgtccatctgcgcgaagccttaagcaccggagagccactg
acggcagatctgatttcgaaagttcatcatgcctggggccttttcatccgcgatggatat
ggccagaccgagtctgcaactctgatcggggtgccgccagaagaaaaagacagtttcggg
acatccggaaaagccatgccaggcttcaaaatcgcgctgctggatgctcagggtgaagag
accgacagcggggaaatctgtgtggatatctcggagagcccctgggggctgatgtcggga
ctggatacttcgaacaaatactttcataccggagacacggcatatctggacagtatgggg
aactttacctattgcgaccgcatcgatggactgttcaagtcctcggactatcgcatcagt
ccttttgagattgaatttgtgttgaaagagtttccatccattcgtgaggcggtggtgatt
ccgagtcctgatcccattcgtgaaaatgtgccgaaagccctggtcatgctgagcaaaggt
gttgagcccagcaaggagctggctttggatattatgaattttgcacgcatgcgcctgtct
cctttcaagcgtattcgccgcgtggagtttatggaaattcccaaaaatacgtctggagaa
gtgctccgctcggatttggtcaatctggagcgcgagaaaagaaagcgcggagaaaaagcc
ccttatgaattctgggaagaagacgccaagatcgtcatccctgacacatgggcgcaagaa
ctgccttga

DBGET integrated database retrieval system