KEGG   Bdellovibrio bacteriovorus HD100: Bd0736Help
Entry
Bd0736            CDS       T00159                                 

Gene name
choA
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bba  Bdellovibrio bacteriovorus HD100
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(697132..698820)
Genome map
AA seq 562 aa AA seqDB search
MNLDYDYIVIGSGFGGSVMTCRLVEKGYKVCLMERGRQWKIGQFPRRPHDVQQRMFWDPE
DQKYGLMELRDTPESDVLSLTASGLGGGSLIYANVLYRMPERFFQGWPQIYNRKSLDPFY
DRVLHMMEAKPYPYETQNYYKATPKTALLKRLAEEMPPPPDSVGKPSFNLPPLAVRFEGS
FPGHQTHNMHGALQSKCNKCGDCDIGCNINAKNSLDLNYIFRARHLKTAEHPADIRTHAD
VVRIEHCGDYYKVTYVIPEFPQQETTFTAKNVVLSAGSIGSTSLLLKMKKQGHLPNLNIW
LGKKWSGNGDLLGLIFGSRENIDATNGPVITGAIEYNFKDYEDGYHHGMYLQEAGFPVGF
AWYLSGKIPQLPGIRGLGTLFAHSIKKYIFKILNIESRDQINVGDEFAQAIDRADFTKRC
FVLLGMGRDKPDGEIRLRSDNQAIIKWKMDGSKLHFDRLRTQMKKIAERIGGVFVDNPLT
HLNKVVAVHPLGGCPMGETPDTGFVNPLGEVYGYKGLYVVDGSILPTSTGPNPSLTIAAV
AEYIAEQIPAKITHKSKETQEA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggattatgattacatcgtgatcggttccggttttggcggctcggtcatgacc
tgccgtctggttgaaaagggctacaaggtctgtttaatggaacgaggccgtcagtggaaa
ataggccagttcccgcggcgccctcatgatgttcaacaacgcatgttctgggacccagaa
gaccaaaaatacggtctgatggagttgcgggacaccccggaaagtgacgtgctgtcactg
acagccagcggacttggcggcggcagcctgatttatgccaacgtcctttaccggatgcct
gaaagattctttcaagggtggcctcagatttacaatcgcaaaagtcttgatccattttac
gaccgcgttctgcacatgatggaagcgaagccctacccttatgaaacgcagaattattac
aaggcgacacccaagaccgcacttttgaaaagactggcagaagaaatgccacctccgcca
gattcagtcggaaagcccagcttcaatttgccgcccctggctgtgcggtttgagggaagc
ttccccggacatcaaacccacaacatgcatggggctttgcagtccaagtgcaataagtgt
ggcgactgcgacatcggctgtaatatcaatgccaagaactctttggatctgaactatatc
ttccgggcccggcatctgaaaacggccgagcatcccgctgatattcgcacccacgcggat
gtcgtgcgtatcgagcactgtggtgactactataaagtgacgtatgtcattccggaattt
ccacagcaggaaaccaccttcacagcgaaaaatgtggttctgtctgccggttccattggc
tcaacatccctgctgttgaaaatgaagaagcaggggcacctgccgaatttgaatatctgg
ctgggaaaaaagtggagtggcaacggcgatctgctgggtttgatttttggatcccgcgaa
aatattgatgccaccaacggcccggtcataacgggtgccatcgaatacaatttcaaggac
tatgaggatggctatcaccatggaatgtatctgcaggaggccggattccctgtaggcttt
gcctggtatctttccggaaaaatccctcaactgcctggcattcgtggactggggaccttg
ttcgctcacagtatcaagaagtacatcttcaaaattctgaatatcgaaagccgtgatcag
atcaacgtcggagatgagttcgcgcaggccattgatcgcgcggatttcaccaaacgctgc
tttgtgcttttgggcatgggaagagataaacccgacggggaaatccgcctgcgttccgac
aaccaggccatcatcaaatggaagatggacggcagtaaactgcactttgatcgtctgcgc
acacaaatgaagaaaatcgccgagcgtattggcggtgtttttgtcgacaatccgctgact
cacttgaacaaggtcgtggccgttcatcccctgggcggctgcccgatgggcgaaaccccg
gacaccggcttcgtgaacccgctgggggaagtgtatggatacaaaggtttgtacgtggtg
gatggtagcatcctgcccacttcgaccggcccgaacccgtccctgaccattgccgccgtc
gccgaatacatcgcggagcaaatcccggcaaagatcacccacaaaagcaaagagacccag
gaagcctag

DBGET integrated database retrieval system