KEGG   Bdellovibrio bacteriovorus HD100: Bd0904Help
Entry
Bd0904            CDS       T00159                                 

Gene name
ccpA
Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bba  Bdellovibrio bacteriovorus HD100
Brite
Enzymes [BR:bba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bd0904 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857411..858499)
Genome map
AA seq 362 aa AA seqDB search
MKTTLKRFWALSVVTCGILLFSGTQAMSENTASKATSDSDKDLAKTAKALFGIIPAKTAA
PDKVSSAQIELGRKIFFDYRLSKDGSTTCVRCHQPQYYSTDRLPQSAGFNNNKGARNAQS
ILNLKYQEIVHWRNDRTSIEDQALRSFTTHLSYGNSSVEEALKRFELAGYQPLFKEAFPD
SKSPLTLENAAAALGIYQRSLTTRAPFDQFLEGDIKAISAQAKKGLREFITVGCASCHNG
TAIGGRTMQKFGVFQNYWNVTKSKTPDKGRQEISKKDEDLYVFKVPSLRNINETAPYFHD
ASAKDLETAIRWMGKLQLNKDLTDDQVSLIKAFLQSLTGELPKDFRIAPTLSPQPYAGPE
PL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaactcttaaacggttctgggctttgtctgtggtgacttgcgggatcctcctc
ttttcaggaacccaagcgatgtcggaaaataccgcttcaaaagcgacttctgatagcgac
aaagacctcgcaaagacagcaaaagcactgtttggaatcattccggcaaaaacggcagcg
cctgacaaagtctccagtgcccagatcgaactgggcagaaagatcttttttgactacaga
ctttccaaggacggcagcaccacctgcgttcgctgccatcaacctcagtactacagcacg
gaccgactgccgcagtctgcgggtttcaataacaacaaaggcgcacgcaacgctcaatcc
atcctgaaccttaagtaccaggagatagttcattggcgcaatgacagaacaagcatcgag
gatcaggccctgcgttctttcaccacccacttaagctatggaaactcctctgtcgaggag
gctttaaaaagattcgagctggccggctaccaacctctgtttaaagaggccttcccggat
tccaagtccccgttgacgcttgagaatgccgccgcggcgctgggaatctatcagcggtca
ctgaccacccgggcgccttttgatcagtttctggagggcgacatcaaggccatctccgct
caggccaaaaaaggcctaagggagtttataactgtagggtgcgcctcctgccacaatggc
acagccataggtggccgaaccatgcaaaagttcggagtctttcagaactactggaatgtg
accaaatccaaaactccggacaagggacgccaggagatcagcaagaaggatgaagatctc
tatgtcttcaaagtgccctcacttcgcaatatcaatgagacagcaccttacttccacgat
gcttcggctaaggatctggaaacggcaattcgttggatgggcaaacttcagctcaataag
gatctgactgacgatcaggtcagcctgatcaaagccttcctgcagagtctgaccggagaa
cttccaaaagatttccggattgctccgacgctttcgccacagccctacgcaggaccagag
ccactgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system