KEGG   Bdellovibrio bacteriovorus HD100: Bd1051Help
Entry
Bd1051            CDS       T00159                                 

Gene name
tpiA
Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bba01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bba01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bba00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bba00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bba00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
996729..997454
Genome map
AA seq 241 aa AA seqDB search
MKKIFAANWKLFKSPKETREFFGQFKELAGKATGEVVFFPSAISLEAASESLKGTSIKFG
AQNCYFQAQGAFTGENSAQVVKDLGGSYVLIGHSERRAIFGEGDALVADKVAFVQGLGLT
PMLCIGETLQERESAKTFRVLETQLNLGLAKADKTKPVVVAYEPVWAIGTGKVATPEQVA
ETHTDVFNILKALGFETAPILYGGSVKPDNAAGLIKQPHVNGFLVGGASLEAKSFSEIAS
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttttgctgctaactggaagctttttaaatctccaaaagaaacgcgtgag
ttttttggtcagttcaaagaactggcggggaaagcaacgggggaagtggtctttttccct
tcagcgatttctttggaagcagccagtgaatctttgaaaggtacaagcatcaagtttggc
gctcagaactgttacttccaggcacaaggggctttcacgggtgaaaactcggctcaggtg
gttaaagatctggggggcagctatgtattgatcggtcacagcgaacgccgtgcgatcttt
ggtgaaggtgatgcgcttgtggcagacaaagtggctttcgttcaaggtctgggcctgacg
ccgatgttgtgcatcggtgaaaccctgcaagaacgcgaatccgcgaagaccttccgtgtt
ctggaaactcagctaaatctgggtttggcgaaggccgacaaaaccaagccagtggttgtt
gcctatgagccggtttgggcgatcgggacggggaaagtggcgacaccagagcaggtggca
gaaactcacacagacgttttcaatattctaaaagcactgggttttgaaacggcaccgatt
ctttatggtggcagcgtaaaaccggacaatgccgctggtttgatcaaacaaccgcatgtg
aatggtttcctggttgggggagcttctttggaagcaaagtccttcagcgagattgcttcc
gtttag

DBGET integrated database retrieval system