KEGG   Bdellovibrio bacteriovorus HD100: Bd1051Help
Entry
Bd1051            CDS       T00159                                 

Gene name
tpiA
Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bd1051 (tpiA)
   01230 Biosynthesis of amino acids
    Bd1051 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bd1051 (tpiA)
   00051 Fructose and mannose metabolism
    Bd1051 (tpiA)
   00562 Inositol phosphate metabolism
    Bd1051 (tpiA)
Enzymes [BR:bba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bd1051 (tpiA)
Exosome [BR:bba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bd1051 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bd1051 (tpiA)
  Exosomal proteins of melanoma cells
   Bd1051 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
996729..997454
Genome map
AA seq 241 aa AA seqDB search
MKKIFAANWKLFKSPKETREFFGQFKELAGKATGEVVFFPSAISLEAASESLKGTSIKFG
AQNCYFQAQGAFTGENSAQVVKDLGGSYVLIGHSERRAIFGEGDALVADKVAFVQGLGLT
PMLCIGETLQERESAKTFRVLETQLNLGLAKADKTKPVVVAYEPVWAIGTGKVATPEQVA
ETHTDVFNILKALGFETAPILYGGSVKPDNAAGLIKQPHVNGFLVGGASLEAKSFSEIAS
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttttgctgctaactggaagctttttaaatctccaaaagaaacgcgtgag
ttttttggtcagttcaaagaactggcggggaaagcaacgggggaagtggtctttttccct
tcagcgatttctttggaagcagccagtgaatctttgaaaggtacaagcatcaagtttggc
gctcagaactgttacttccaggcacaaggggctttcacgggtgaaaactcggctcaggtg
gttaaagatctggggggcagctatgtattgatcggtcacagcgaacgccgtgcgatcttt
ggtgaaggtgatgcgcttgtggcagacaaagtggctttcgttcaaggtctgggcctgacg
ccgatgttgtgcatcggtgaaaccctgcaagaacgcgaatccgcgaagaccttccgtgtt
ctggaaactcagctaaatctgggtttggcgaaggccgacaaaaccaagccagtggttgtt
gcctatgagccggtttgggcgatcgggacggggaaagtggcgacaccagagcaggtggca
gaaactcacacagacgttttcaatattctaaaagcactgggttttgaaacggcaccgatt
ctttatggtggcagcgtaaaaccggacaatgccgctggtttgatcaaacaaccgcatgtg
aatggtttcctggttgggggagcttctttggaagcaaagtccttcagcgagattgcttcc
gtttag

DBGET integrated database retrieval system