KEGG   Bdellovibrio bacteriovorus HD100: Bd1223Help
Entry
Bd1223            CDS       T00159                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00010  Glycolysis / Gluconeogenesis
bba00052  Galactose metabolism
bba00500  Starch and sucrose metabolism
bba00520  Amino sugar and nucleotide sugar metabolism
bba00521  Streptomycin biosynthesis
bba01100  Metabolic pathways
bba01110  Biosynthesis of secondary metabolites
bba01120  Microbial metabolism in diverse environments
bba01130  Biosynthesis of antibiotics
bba01200  Carbon metabolism
Module
bba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bd1223 (glk)
   00052 Galactose metabolism
    Bd1223 (glk)
   00500 Starch and sucrose metabolism
    Bd1223 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Bd1223 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bd1223 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bd1223 (glk)
Enzymes [BR:bba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bd1223 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FeoA DUF5333
Motif
Other DBs
NCBI-ProteinID: CAE79127
UniProt: Q6MNM4
Position
complement(1158742..1159704)
Genome map
AA seq 320 aa AA seqDB search
MKKKTYTIGLDLGGTKLAAALLSDTGEMLDFIKVPVDMNREKSAPKAQKRLIQLMTDIAL
DFKKRFPNETKASVFRGIGLASAGPLNAETGTLMNPANYPGWKIVPILDLLTKEIHKTWK
TPVFFQHDATAAALAEGWVGGAQKMKSFAIVTIGTGVGTGVIFNGLPGQSDGMGSEYGHI
VVDYQRLMKNPEKIDHCTVEGIASGTGLLRRAREMGFTGNSVEELIAANDAKYQVLFKEM
AWALAILCYNLSIGYNLEKIFLSGGLIKIRNMYLKDLKDHYKKMIRQSKTVFECPIEVAK
TQNHAGVIGAGFLPHLYGKK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaacctacaccatcggtcttgatctgggcggaaccaaactggcagcagcg
ctgctttctgataccggcgaaatgctggatttcatcaaggttccggtcgacatgaaccgc
gagaagtccgcacccaaggcccaaaagcgcctgattcaactgatgacggacattgctctg
gatttcaaaaaacgtttcccgaacgaaaccaaagcctctgtctttaggggcattggtctg
gccagcgcaggtcctttgaatgctgaaaccggcactctgatgaatcctgccaactatcca
ggctggaagatcgttccgatcctggatctgctgaccaaagagattcacaaaacctggaag
accccggtgttcttccagcacgatgccacggcggcagctttggctgaaggctgggttggt
ggcgcacagaaaatgaagtcctttgcgatagtcaccatcggcacgggtgtgggcactggc
gtgatctttaacggcctgccgggccagtctgacggcatgggctctgaatacggccatatc
gttgttgattaccagcgcctgatgaaaaatccggaaaagatcgaccactgcacagtggaa
ggcattgcttccggcacgggccttcttcgtcgcgcacgcgagatgggtttcactggaaat
tccgtggaagaactgattgccgccaacgatgccaagtaccaggtgctgttcaaggaaatg
gcctgggcattggcgattctttgctataacctttctatcggctacaaccttgagaagatc
ttcctcagcggcggtctgatcaagattcgtaacatgtacttaaaagacctgaaggatcac
tacaaaaagatgatccgccaaagcaagacggtctttgaatgcccgattgaagtggccaag
actcagaaccatgcaggcgttatcggcgcgggcttcctgccccacctttacggaaaaaaa
taa

DBGET integrated database retrieval system