KEGG   Bdellovibrio bacteriovorus HD100: Bd1223Help
Entry
Bd1223            CDS       T00159                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bd1223 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bd1223 (glk)
   00052 Galactose metabolism
    Bd1223 (glk)
   00500 Starch and sucrose metabolism
    Bd1223 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Bd1223 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bd1223 (glk)
   00524 Butirosin and neomycin biosynthesis
    Bd1223 (glk)
Enzymes [BR:bba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bd1223 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1158742..1159704)
Genome map
AA seq 320 aa AA seqDB search
MKKKTYTIGLDLGGTKLAAALLSDTGEMLDFIKVPVDMNREKSAPKAQKRLIQLMTDIAL
DFKKRFPNETKASVFRGIGLASAGPLNAETGTLMNPANYPGWKIVPILDLLTKEIHKTWK
TPVFFQHDATAAALAEGWVGGAQKMKSFAIVTIGTGVGTGVIFNGLPGQSDGMGSEYGHI
VVDYQRLMKNPEKIDHCTVEGIASGTGLLRRAREMGFTGNSVEELIAANDAKYQVLFKEM
AWALAILCYNLSIGYNLEKIFLSGGLIKIRNMYLKDLKDHYKKMIRQSKTVFECPIEVAK
TQNHAGVIGAGFLPHLYGKK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaacctacaccatcggtcttgatctgggcggaaccaaactggcagcagcg
ctgctttctgataccggcgaaatgctggatttcatcaaggttccggtcgacatgaaccgc
gagaagtccgcacccaaggcccaaaagcgcctgattcaactgatgacggacattgctctg
gatttcaaaaaacgtttcccgaacgaaaccaaagcctctgtctttaggggcattggtctg
gccagcgcaggtcctttgaatgctgaaaccggcactctgatgaatcctgccaactatcca
ggctggaagatcgttccgatcctggatctgctgaccaaagagattcacaaaacctggaag
accccggtgttcttccagcacgatgccacggcggcagctttggctgaaggctgggttggt
ggcgcacagaaaatgaagtcctttgcgatagtcaccatcggcacgggtgtgggcactggc
gtgatctttaacggcctgccgggccagtctgacggcatgggctctgaatacggccatatc
gttgttgattaccagcgcctgatgaaaaatccggaaaagatcgaccactgcacagtggaa
ggcattgcttccggcacgggccttcttcgtcgcgcacgcgagatgggtttcactggaaat
tccgtggaagaactgattgccgccaacgatgccaagtaccaggtgctgttcaaggaaatg
gcctgggcattggcgattctttgctataacctttctatcggctacaaccttgagaagatc
ttcctcagcggcggtctgatcaagattcgtaacatgtacttaaaagacctgaaggatcac
tacaaaaagatgatccgccaaagcaagacggtctttgaatgcccgattgaagtggccaag
actcagaaccatgcaggcgttatcggcgcgggcttcctgccccacctttacggaaaaaaa
taa

DBGET integrated database retrieval system