KEGG   Bdellovibrio bacteriovorus HD100: Bd1306Help
Entry
Bd1306            CDS       T00159                                 

Gene name
acs
Definition
acetyl coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bba01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bba00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bba00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bba00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bba00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1234410..1236347
Genome map
AA seq 645 aa AA seqDB search
MHKELYPVNSEVAKKAWIDEAKYKAMYERSIQDNEAFWAEQAERLDWIKKWDKVKEVSFK
KPVSIKWYLGGKMNVSYNCVDRHLKTRGDKTALLWEADNPSTPSRKITYKELHLEVCRFA
NVLKKMGVKKGDVVTIYMPMIPDTAVAMLACARIGAVHSVVFAGFSPDSISDRILDGQCR
FVITGDAGFRGSKVVALKENIDKALVKTPDVQKVLVVKYAGTTVDMKPGRDLWYHEEVKT
VSDQCEPEPMDAEDPLFILYTSGSTGKPKGVMHTTGGYLVYASMTHQYVFDYHEDDIYWC
SADVGWVTGHSYIVYGPLANGATSLFFEGVPNYPTPSRFWEVVDKHKVTIFYTSPTAIRS
LMREGDAAVKTTSRKTLRLLGSVGEPINPEAWAWYHDVVGEGRCPVVDTWWQTETGGILI
TPLPGAIAQKPGSATLPFFGVQPKLLTNEGQEIHGPGEGVLVIADSWPGQMRTVYRNHER
FEDTYFSNYPGYYFTGDGCRRDQDGYYWITGRVDDVINVSGHRLGTAEIESALVAHHKVA
EAAVVGYPHDIKGQGIYAFVTLKSGETASEELRKELIQTVRKEIGPIATPDLIQWAPRLP
KTRSGKIMRRILRKIAENHPDQLGDTTTLSEPAVVQELVDNRMNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaagaactttatcccgtgaattccgaggtggcgaaaaaagcctggattgatgaa
gccaaatacaaagccatgtatgagcgctccattcaagacaacgaagccttttgggccgag
caagccgagcgcctggactggatcaaaaagtgggataaggtcaaagaagtcagtttcaag
aaacccgttagcatcaaatggtacttgggtggaaaaatgaatgtgtcctacaattgcgtg
gaccgtcatttaaaaacccgcggcgacaaaacagccctgctgtgggaagccgacaatcca
tccacaccttcacgcaaaatcacttacaaagaactgcatctggaagtgtgccgcttcgcc
aatgtcctgaaaaaaatgggcgtgaaaaaaggcgatgtggtgacgatctatatgccgatg
attccggatacagccgtggcgatgctggcctgtgcgcgcatcggggcggttcattcggtg
gtgtttgccggtttttctccggattccatctcagatcgtattttggacgggcagtgccgg
tttgtgatcaccggtgatgccggcttccgcggcagcaaagtggtggcgttaaaagaaaat
atcgataaagcacttgtgaaaactccggacgtgcaaaaagttctggtggtgaaatatgcg
ggcacgacggtggacatgaagccgggccgtgatctttggtatcacgaagaagtcaaaacc
gtcagcgaccagtgtgaaccagaacccatggacgcggaagatcctttgtttattctttac
acttccggttccacaggaaaacccaaaggggtgatgcacaccacggggggatatctggtg
tatgccagcatgacccaccagtatgtctttgattatcacgaagatgatatctactggtgt
tctgctgacgtgggttgggtgaccggccatagctatatcgtgtatggcccgctggcgaat
ggggcgacaagtttgttctttgaaggggtgccgaactatccaactccaagccgtttctgg
gaagtggtcgacaaacacaaagtcacaatattctatacctcaccaacggcgattcgttct
ttgatgcgcgaaggggacgcggcggtgaaaaccacctcgcgaaaaaccctgcgcctgctg
gggtccgtcggggagccgatcaatccggaagcctgggcatggtatcacgatgtggtcggt
gaaggacgctgcccggttgtcgatacatggtggcagacagaaaccggtggcattctgatc
acgccactgccgggggcgattgcgcaaaagccggggtctgcaactttaccgttctttggg
gtgcaaccgaaacttttgaccaacgaaggacaagagatccatggaccgggcgaaggggtg
ctggtgattgcggattcctggccgggccagatgcgcacggtgtatcgcaatcacgaacgt
tttgaagacacgtatttctcgaactatcccgggtactatttcacaggcgacggctgtcgt
cgcgatcaggacgggtattactggatcacgggacgggtggatgacgtgatcaacgtttcc
ggtcaccgcctggggacggctgaaattgaatcagcgcttgtggcccatcacaaagtggct
gaagccgccgtggttggatatccacatgatatcaaagggcaggggatttatgcctttgtc
accttgaagtccggtgaaacggccagtgaagagctgcgtaaagagctgattcagaccgtg
cgtaaagagatcgggccgattgcgactccggatctgattcagtgggctccacgtctgccg
aagacccgttctggcaagattatgcgccgaatcctgcgtaaaatcgccgagaaccacccg
gatcaactgggggatacgacaaccttgtcagagcctgcggtggtccaagaactggtggac
aatcgcatgaaccggtga

DBGET integrated database retrieval system