KEGG   Bdellovibrio bacteriovorus HD100: Bd1568Help
Entry
Bd1568            CDS       T00159                                 

Gene name
gmk
Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bba00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1493569..1494039
Genome map
AA seq 156 aa AA seqDB search
MVDIVTFTTRSIRQGETPGLQYNFIDHADFEQKIKEGFFVEWAKVHTNFYGTSYSSLETA
WNQGKTAIMDIDIQGVATFKSKFPDAKTVFIHPPSIDELRRRIEKRDGKVPADIEVRMAN
AEKEIREASKFDYQIVNDVFEKSYGEFKKIVEDLLA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
ttggtggatatcgtcactttcacaacgcgctctatccgccagggagagacgccgggtctg
cagtacaatttcattgatcatgctgattttgaacagaagatcaaagagggcttctttgtg
gagtgggcgaaggttcacaccaatttctatggaacctcatattcgtccctggaaacagcc
tggaatcagggtaaaaccgccattatggacatcgacatccagggtgtggcgacctttaag
tccaagttcccggacgctaaaaccgtctttatccatcccccgagtattgacgagctgcgt
cgtcgcattgaaaagcgcgatggcaaggtccctgcggacattgaagttcgtatggccaat
gccgaaaaggagatccgtgaggcctccaagttcgattatcagatcgtcaacgacgtgttt
gagaaatcctatggggaatttaagaaaatcgttgaagatttgctagcttag

DBGET integrated database retrieval system