KEGG   Bdellovibrio bacteriovorus HD100: Bd1836Help
Entry
Bd1836            CDS       T00159                                 

Definition
fatty oxidation complex, alpha subunit (EC:1.1.1.35 4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bd1836
   01212 Fatty acid metabolism
    Bd1836
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bd1836
   00650 Butanoate metabolism
    Bd1836
  Lipid metabolism
   00071 Fatty acid degradation
    Bd1836
   01040 Biosynthesis of unsaturated fatty acids
    Bd1836
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bd1836
   00310 Lysine degradation
    Bd1836
   00380 Tryptophan metabolism
    Bd1836
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bd1836
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bd1836
   00281 Geraniol degradation
    Bd1836
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Bd1836
Enzymes [BR:bba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Bd1836
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bd1836
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Bd1836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1763200..1765353
Genome map
AA seq 717 aa AA seqDB search
MSIQESIKIVPQGEVAVVEFDLVGEKVNKFSTPVMMRLKEVVEELKKSSYKAVIFKSNKP
KIFIAGADIEEIKSMTKAEEFEAAVKGGQEVISMVEDLPMPTIAAVNGACMGGGCEFILA
CDYRIASEDSSTKIGLPEIQLGILPGFGGCIRMPRVIGLQAALDIILAGKSVNSKKALKI
GLVDKVVHPNLLESFSLKWAKEIIADGAKKRRKTFKPQGAVNVILESALGRSIVFKKARE
GVLKATKGHYPAPLQALEVIQKTYGMSDRDAALRIEREGFCKLGVTDISKNLIHVFYLTE
MVKKQNGVPGVDVKPRDVKGLGVLGAGTMGGGIAYVAADKGIQVRMKDLNTDALGKGLKH
ASDLWMKLVKRKSIDKYQFQQKMDLVSVSTDYAGFKNLDVVVEAIVEDMGIKQKVIGECA
GQMRPDAIIATNTSSLSVTEMAKGHPRPEYFAGMHFFNPVNKMPLIEVIRGEKTSDETIA
TIYELSKKMGKMPVVVKDGPGFLVNRLLLPYMGEAAFLLQEGMSIEFVDKVYVKEFGMPM
GPFELMDEVGLDVCLKVLKIFKKAFGERIELAPCMEALGNSGRLGRKNGKGFYTYSEDGK
RGAVDQTVYAALGLGQPTNPYDSKECIERGVFAMINECSLALVEDRIVETPHEVDLAMIM
GTGFPPFRGGLMKYTDSIGTQYVADQLAMYASSRKAARLKPATPLTNMAKSNSKFYK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgtctattcaggaaagtattaaaattgttcctcagggtgaggttgctgtagttgagttt
gatctggtcggggagaaagttaataagttctctacgccggtgatgatgcgccttaaggaa
gttgttgaggagttgaagaagtcctcttacaaggctgttatttttaaatccaacaagccc
aagatttttattgcgggtgcggatattgaagaaatcaagagcatgaccaaggcggaggaa
tttgaagctgctgtgaagggtggtcaggaagttatcagcatggttgaagacctgccgatg
ccgacgattgcggctgtgaatggcgcttgcatgggtgggggttgtgaattcatccttgct
tgtgattaccgtattgcttctgaggattcttccacgaaaattggcctgccagagattcaa
ctggggatcttgcctgggtttggtggctgtattcgtatgcctcgcgtgattggtttgcag
gcggctttggatattatcctggctggtaagtctgtgaattccaaaaaggctcttaaaatc
ggtctggtggacaaagtcgttcacccgaacttgctggagtccttctctttgaaatgggcg
aaagaaatcatcgctgatggcgctaaaaaacgccgtaaaacattcaagccacaaggcgca
gtgaatgtgattttggaaagcgcattgggtcgcagcattgtctttaagaaagcccgtgag
ggtgttctgaaagcgaccaaaggtcattatccagcgccgcttcaggctttggaagtgatt
cagaaaacttatggcatgtctgatcgtgatgcggctttgcgcattgaacgtgagggcttc
tgtaagttgggtgtgacggatatttccaagaacctgatccacgtgttctatctaactgaa
atggtgaaaaaacaaaacggtgtgccgggtgtggatgtgaaaccacgcgatgtgaaaggt
ctgggtgttttgggtgctggcaccatgggtggcggtatcgcctatgtggcggccgacaag
ggcattcaggttcgcatgaaggacttgaacacagatgcgctgggtaagggtttgaaacac
gccagtgatctttggatgaaactggtgaaaagaaaatccatcgacaagtatcagttccag
caaaaaatggatctggtgtctgtttccacggattacgcaggtttcaaaaatctggatgta
gttgttgaagccatcgttgaagacatgggcatcaaacaaaaagtgatcggcgagtgcgcg
ggtcaaatgcgtcctgatgcaattatcgcgactaacacaagctccctttctgtgactgaa
atggccaaaggtcatccacgtccagaatatttcgcgggcatgcacttcttcaatccggtg
aataaaatgcctcttatcgaggtcatccgtggtgaaaagacttccgatgaaaccattgca
actatctacgagctgtccaaaaaaatgggcaaaatgccggtggttgtgaaagacggcccg
ggtttcctggtgaaccgtttgcttcttccttacatgggtgaagcggcgttcttgcttcag
gaaggcatgagcatcgaatttgtggataaagtttacgtgaaagaattcggcatgccgatg
ggtccatttgaattgatggacgaagtcggtttggatgtttgtttgaaggttcttaaaatc
ttcaaaaaagccttcggcgagcgtattgaacttgcgccttgtatggaagctctgggtaac
tccggtcgcctgggtcgtaagaacggcaaaggtttctatacttacagcgaagatggcaaa
cgtggtgccgtagaccaaacagtttacgcggcattgggcctgggtcagccaaccaatccg
tatgattccaaagaatgcatcgagcgtggtgtctttgcgatgatcaatgagtgctctttg
gcgctggttgaagatcgtatcgtcgaaactccgcacgaagtggatctggcgatgatcatg
ggtacaggcttcccgccgttccgtgggggtctgatgaagtacacggacagcatcggcact
cagtatgtggccgaccagctggcgatgtacgcttccagccgcaaggcagcccgcctgaaa
ccagcgactccgctgacgaacatggcgaaatcaaacagcaagttctataaataa

DBGET integrated database retrieval system