KEGG   Bdellovibrio bacteriovorus HD100: Bd1947Help
Entry
Bd1947            CDS       T00159                                 

Gene name
bsaA
Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bd1947 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bd1947 (bsaA)
Enzymes [BR:bba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bd1947 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1859443..1860099)
Genome map
AA seq 218 aa AA seqDB search
MIKSKVRTASKGFPRAFSCDLPPPPLEYAHQGETMRIFTLIALILCTSFAWAKDTPSSFF
DLSANSLSGKKVNFSTYRGKVVLVVNTASQCGFTPQLKELEEMYKKYADRGFVVLGFPSN
DFKQEKGTNDEVQTFAAKEFGVTFPLFDKAPVSGKDIQPVYQFLTTQKPGLIFKDVAWNF
EKFLINRKGQVVERWSSITKPSSDSITKSVEKALNEPL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgataaagtcaaaggtgcgcactgcatccaaaggctttcccagggctttttcttgtgat
ttacccccgccccctctagaatacgctcatcagggggaaaccatgcgtatttttactctt
atcgccctaattttgtgcacttcctttgcttgggccaaggacacaccatcgagcttcttt
gatctttccgcgaactcgctttccggcaaaaaggtcaacttctccacgtaccggggcaag
gtcgttttggtggtcaacaccgcctcacaatgcgggttcactccccaactgaaagagctg
gaagaaatgtacaaaaaatacgcagaccgcggtttcgtggttctgggttttccttccaac
gatttcaaacaggaaaaaggaacgaacgacgaagttcagacttttgccgccaaggaattt
ggcgtgaccttcccgttgtttgataaagcaccggtcagcggtaaagacatccagccggtt
tatcaattcctgacgacacaaaaaccgggtttgatttttaaagacgtggcctggaacttt
gaaaagttcctaatcaaccgcaaaggtcaggtggtcgaacgctggagttccatcaccaaa
ccatcctcggactccatcacaaaatccgtggaaaaagccctgaacgaacccctctaa

DBGET integrated database retrieval system