KEGG   Bdellovibrio bacteriovorus HD100: Bd1947Help
Entry
Bd1947            CDS       T00159                                 

Gene name
bsaA
Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bba00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bba00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1859443..1860099)
Genome map
AA seq 218 aa AA seqDB search
MIKSKVRTASKGFPRAFSCDLPPPPLEYAHQGETMRIFTLIALILCTSFAWAKDTPSSFF
DLSANSLSGKKVNFSTYRGKVVLVVNTASQCGFTPQLKELEEMYKKYADRGFVVLGFPSN
DFKQEKGTNDEVQTFAAKEFGVTFPLFDKAPVSGKDIQPVYQFLTTQKPGLIFKDVAWNF
EKFLINRKGQVVERWSSITKPSSDSITKSVEKALNEPL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgataaagtcaaaggtgcgcactgcatccaaaggctttcccagggctttttcttgtgat
ttacccccgccccctctagaatacgctcatcagggggaaaccatgcgtatttttactctt
atcgccctaattttgtgcacttcctttgcttgggccaaggacacaccatcgagcttcttt
gatctttccgcgaactcgctttccggcaaaaaggtcaacttctccacgtaccggggcaag
gtcgttttggtggtcaacaccgcctcacaatgcgggttcactccccaactgaaagagctg
gaagaaatgtacaaaaaatacgcagaccgcggtttcgtggttctgggttttccttccaac
gatttcaaacaggaaaaaggaacgaacgacgaagttcagacttttgccgccaaggaattt
ggcgtgaccttcccgttgtttgataaagcaccggtcagcggtaaagacatccagccggtt
tatcaattcctgacgacacaaaaaccgggtttgatttttaaagacgtggcctggaacttt
gaaaagttcctaatcaaccgcaaaggtcaggtggtcgaacgctggagttccatcaccaaa
ccatcctcggactccatcacaaaatccgtggaaaaagccctgaacgaacccctctaa

DBGET integrated database retrieval system