KEGG   Bdellovibrio bacteriovorus HD100: Bd2488Help
Entry
Bd2488            CDS       T00159                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bd2488 (ruvA)
Enzymes [BR:bba01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bd2488 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2391710..2392300)
Genome map
AA seq 196 aa AA seqDB search
MIGYLRGKIIEVMNDSALIDVSGVGYEIHASSNTLGDLQALLGNDIIVWIHTHVREDALQ
LFGFHDKEEKNLFLSLLKVNGVGPKMALSILSGGRPAQIHEMIEAGNAKALSGLPKVGKK
TAEQIILTLKGKLVSIEEGGVVAKAKSVAHTQITSALLNLGYKSQLVDQFVSSLPADIAV
EDGIRKGFQTLSGGLS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgattggatatttgcgcggtaaaattattgaagtgatgaacgactccgctttgatcgac
gtcagtggggtgggttatgaaatccacgcttccagcaacacgctgggggatctgcaggcg
cttttggggaacgacatcatcgtctggattcacactcacgtgcgtgaagacgctttgcaa
cttttcggtttccacgacaaagaggaaaaaaatctgttcctgtcgttgttgaaagttaac
ggtgtcggtccgaagatggccctgagcattctttccggcggccgtccggcgcaaattcat
gaaatgatcgaagcggggaatgcgaaagctttgtcgggcctgccaaaagtgggcaagaaa
accgccgaacagatcattctgaccctgaaaggcaagctggtgtccatcgaagaaggtggc
gtggtggcgaaagccaaatccgtggcgcacactcagatcacttcagcccttttgaatttg
ggctacaaatcccagttggtggatcagtttgtttcctcgttgccggcggacatcgctgtt
gaagatggcatccgcaaaggcttccagaccctgtctggaggcttgtcatga

DBGET integrated database retrieval system