KEGG   Bdellovibrio bacteriovorus HD100: Bd2618Help
Entry
Bd2618            CDS       T00159                                 

Gene name
pcm
Definition
(GenBank) L-isoaspartyl protein carboxyl methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bba  Bdellovibrio bacteriovorus HD100
Brite
Enzymes [BR:bba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bd2618 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_31 GCD14 Fibrillarin CMAS Ubie_methyltran Methyltr_RsmB-F DOT1 Methyltransf_23 Methyltransf_3 Methyltransf_11 Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: CAE80412
UniProt: Q6MJZ7
Position
complement(2535203..2535925)
Genome map
AA seq 240 aa AA seqDB search
MIQACRSGKKLASLIMGLSLEHYQQSVLKRALPLSEKVVEAFYSQPRHLFVPEYTVEEAY
EDHPLVLFNNPPYVSTISQPSFVLRILDLLKLGPGQKVFELGTGSGWNTAMMAEIVGAAG
KVVSVEVIAELAERAQKILRERNLPQVLVKAGDGFEGDAANAPYDRVIFTAGSSEFPQKV
FEQLKESGWMVFVRKNRGSPDMLELIHKVQSEPHVVTSVPCSFVNVVREKAGPDSKEQSL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgatacaagcttgccgttcaggaaaaaagcttgcaagcttaatcatgggcttgtcattg
gaacactatcaacaaagtgtcttgaagcgcgcactgccactgtctgaaaaagtggtggag
gctttttacagtcaaccccgccatttattcgtgccggaatacacagtggaagaagcctac
gaagatcatccgctggtgcttttcaacaatcctccttatgtgtccaccatctcacaaccc
agttttgttctgcgcattctggatcttttgaagctgggtcctggtcaaaaggtgttcgag
ctgggaaccggcagtggatggaacacggctatgatggctgaaattgtcggggccgcaggc
aaggtggtttccgttgaagtgattgctgaactggcagagcgggcccaaaagattctgcgt
gaacgcaatttgcctcaggtgcttgtcaaggccggagacggctttgagggggatgcggcc
aatgccccctacgaccgggtcattttcaccgctgggtcttccgagtttccgcagaaggtt
tttgaacagttaaaagaatctggatggatggtgtttgtgcgaaaaaaccgcggttcaccg
gatatgctggagctgattcacaaggtgcagtccgagcctcatgtggtgacttcggtgcca
tgctcttttgtcaatgtggtgcgggaaaaagcggggcctgattcgaaagaacaaagtctt
tga

DBGET integrated database retrieval system