KEGG   Bdellovibrio bacteriovorus HD100: Bd2646Help
Entry
Bd2646            CDS       T00159                                 

Gene name
choD
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bba  Bdellovibrio bacteriovorus HD100
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Bd2646 (choD)
Enzymes [BR:bba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Bd2646 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2569433..2571181
Genome map
AA seq 582 aa AA seqDB search
MKSYFSRRSFLKSSMAAGALGLLKSEDASAAPEIHRVNLTMDYTRLADSFSELESFYEVV
VIGSGYGGAIMGARLSPHHQVAILERGREWRPGEYPETFHELKKQIYCDSQPLGLFSYHT
HRDIDVVCGSGLGGTSLINAGVVIRPDRDLYSKKGWPQEIRTEADQGTFEKYYQRVEKML
HIQSHDPRKTKIRKAENLHHSSEALGDPFTWARIAVNLHGPHRNESGDTQPKCHMCGNCS
TGCNTGAKNTLNMNYLPMAKKHGARIFTQMQVSHIERNKQGNYVVRGTHVSAGTKRPFRI
EARNVVVSAGTMGSNQILLRSQKLGNLKFSQELGQHFSGNGDLLGLGFNGDTATDMLGNS
SAKIFRPGMISGATIYGIADYRQRKNIFERFLIEEGNIPGALVQLARRLTTFVKAPTSPS
KIYRAWLDFIDSKDFEKGSMNHSMVYFGMGHDRGLGRLVLNSQNRVVVQWPGVQQDPIFK
RMIAKIKQHVSVNNSTYVKNPRSTFMGGNNLITVHPLGGCSMGDSVTAGVVNHLGQVYHP
EGGLYEGLFVMDGSIIPTAVGVNPLLTISALAERAAEHIELR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatcttatttctcacgtcgatcctttctaaaatcctcgatggctgcgggagcactg
gggcttcttaaatccgaagacgcttcggccgcccctgaaattcaccgggtgaatctgacc
atggactacacccgcctggcggattccttttccgaacttgaaagcttttatgaggtggtc
gtcatcggctccggctatggcggagccatcatgggcgcacgcttaagcccccaccatcaa
gtcgccatcttagagcgcggccgggagtggcgccccggcgaataccccgagacctttcac
gaactcaaaaaacaaatctattgcgacagccaaccgctggggctgttctcgtatcacacc
catcgtgacatcgatgttgtctgcggcagcggcctgggaggaacatccctgatcaatgcc
ggggtggtgattcgtccggatcgggatttgtattcaaaaaaaggctggccccaggaaatt
cgcacggaggcagaccagggaacttttgaaaaatactatcagcgcgttgaaaagatgctc
cacatccagtcacacgatccacgcaaaacaaagatccgcaaagccgaaaatctgcaccac
agcagcgaggctttgggggacccattcacctgggcgcgaattgctgtgaaccttcacggc
ccccatcgcaatgaatccggcgacactcagccgaaatgccatatgtgcggcaattgcagc
acgggctgcaacacgggagctaaaaacactctgaatatgaactatctgcccatggcgaaa
aaacacggcgcccgaattttcacccagatgcaggtcagccacattgagcgaaacaaacaa
gggaactatgttgtcagaggcacccacgtctctgcaggcacgaaaaggccttttcgcatc
gaggcccgcaatgttgtggtttctgccggcaccatggggtcgaaccaaatcctgttgcgc
tctcagaagttgggcaatctgaagttttcgcaagaactggggcagcacttttccggcaac
ggggatttgctcggactgggttttaacggcgacaccgcgacggacatgctgggaaactcg
agcgcgaaaatattccggccgggtatgatttccggggccaccatctatggaatcgccgac
tatcgccagcgaaaaaacatctttgaaagatttttgatcgaagaaggcaacatccccgga
gccctggtgcagctggcaagacgccttaccaccttcgtcaaagccccaacctcgccgtca
aagatctatcgggcatggcttgattttattgacagcaaggactttgaaaaaggttcgatg
aatcattcgatggtctattttggcatgggccacgaccggggcctgggacgcctggtcctg
aacagtcaaaaccgcgtcgtggttcagtggcccggcgtgcagcaggatccgatattcaag
cgcatgatcgccaagataaaacaacacgtcagcgtcaataactccacctacgtcaaaaat
ccgcgcagcacttttatgggcgggaacaacctgatcaccgtgcacccgttgggcggatgc
tccatgggcgattctgtcactgcaggcgtcgtcaatcatctgggccaggtctatcacccc
gagggcggtttgtacgaaggtctttttgtgatggacggatcgatcatccccaccgccgtc
ggggtcaatcccctgctgacgatttctgccttggcggaacgagccgccgagcacatcgaa
cttcgctaa

DBGET integrated database retrieval system