KEGG   Bdellovibrio bacteriovorus HD100: Bd2718Help
Entry
Bd2718            CDS       T00159                                 

Gene name
glpK
Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bba00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2639102..2640589)
Genome map
AA seq 495 aa AA seqDB search
MFMSSFIMAIDQGTTSSRTCIINQAGGLVAEAREAFKQIFPKPGWVEHDPEDIWYSTQRS
MRLALEKAKIKGSQIRTIGITNQRETVMLWDAKSGKALHNAIVWQCRRTQDLCEKLKKNK
KEKIITAKTGLVLDPYFSATKIQWLLKNVPNAAKKAKDGQALAGTVDSFLLWKLTAGHSH
KTDVSNASRTMLMNIHTGWWDEDLLKIFGVPEAILPEICPSNSDFGVTQGLGFMPDGIPI
TGIVGDQQAALFGQTCFETGDSKCTFGTGSFLLLNTGKKAVKSKNKLLTTIAWKLKNQEM
TYALEGGAFVCGAAVQWLRDGLGLIQQSSDVEALAKTVDGTDGVEFVPALTGLGAPHWQP
EARGLICGLTRGSTKAHIARATLEAMALQNVDILNTMQRDLGKKLRGVRVDGGAAANDLL
MQMQADYCGANVVRPQNLETTALGAAFMAGLGAGVWKDLKEIKRVWKVNKEFKVKMTPKA
RKERLQRWAQALERV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgtttatgtcttcttttatcatggccattgaccaagggacaaccagctcaagaacatgc
attatcaatcaagccggaggtcttgtcgccgaggctcgtgaggcattcaaacaaatcttc
ccgaaaccaggctgggttgaacatgatcctgaagatatctggtattccacgcaaaggtcc
atgcgtctggcgctggaaaaagcaaaaatcaaaggatcgcagattcgcacgattggcatc
accaatcagcgtgaaactgtgatgctttgggacgcgaagtccggaaaagccctgcataac
gccattgtctggcagtgtcgccgcacgcaggatctgtgtgaaaagctcaagaaaaacaaa
aaagaaaagatcatcaccgccaagacgggtttggtgctggatccttatttctcagccacc
aaaattcagtggttgcttaagaatgtcccgaacgcggcaaagaaggccaaagacgggcag
gctctggccggcaccgtcgacagcttcttgttgtggaaactgactgcagggcattcacat
aagacagatgtcagtaatgcctcccgtacgatgttgatgaacatccacaccgggtggtgg
gatgaggaccttttgaaaatctttggtgtgcctgaagccatcctgccagagatctgtccg
tccaattctgattttggtgtgacccaaggtctgggttttatgcccgacggaattccaatc
acaggtattgtgggggaccagcaggcggccttgtttgggcagacatgttttgaaaccgga
gattccaagtgcaccttcggcaccggaagtttcctgcttttaaacaccggcaaaaaagcc
gtgaaatcgaaaaacaaattgctgaccacgattgcctggaaactaaaaaatcaggagatg
acttacgcactggagggtggcgcctttgtctgtggagctgcggttcagtggctgcgcgac
ggcctggggttgatccagcagtcttcggatgttgaagctctggcaaaaacagtcgacggc
actgatggggtggaatttgttcccgccctgacgggactgggggctccgcactggcagccg
gaagcacgtggcctgatttgcggtcttacccgtggcagcaccaaagcccacattgcgcgc
gcgacgttggaagccatggccttgcaaaacgtggatatcctgaacaccatgcaaagagat
ctgggaaaaaagctgcgcggagtccgtgtcgacggaggtgcggcggccaatgatttgtta
atgcagatgcaggcggattactgcggagccaacgtggttcgtccccaaaatcttgaaacg
acagctttgggggccgcatttatggcgggtcttggggctggtgtgtggaaagacctgaaa
gagatcaaacgcgtctggaaagtgaacaaagaattcaaagtaaagatgaccccgaaagcc
cgcaaagaacgtttgcagcgctgggcacaggcgctggagcgagtgtaa

DBGET integrated database retrieval system