KEGG   Bdellovibrio bacteriovorus HD100: Bd2729Help
Entry
Bd2729            CDS       T00159                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bd2729 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bd2729 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Bd2729 (sucB)
Enzymes [BR:bba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bd2729 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2653248..2654507
Genome map
AA seq 419 aa AA seqDB search
MKQEIKVPAVGESITEATIGSWTKKSGDFVKRNEVLMLLETDKASVEVVAENDGVLTINP
GCEAGAVVQIGATVATLDTDAKPAAGAAAPAAETAKAAAPASAPAGAAALPAAAGKDASA
HLSPAVNRIVNEKGLDPSAIQGTGKDGRLTKGDVLEAQPGAKPAAPKAAPASAPTGAPAL
PAAASKQGDKKLVPMTTIRKRISEKLKEAQNTAALLTTFNEVDMGKVMELRSKYKDKFKE
KYGVNLGFNGFFVKAVVEALKDFPAVNAWINGTDIEYHNYYNIGIAVSTEKGLMVPNVKD
ADTLSLAGIELAIRDLAAKGRDGKITPNDLGGGTFSITNGGVFGSLLSTPILNFPQSAIL
GLHKIQDRPMAINGKVEIRPMMYLALTYDHRIIDGKEAVSFLVKIKELVEDPERLLLEV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagagattaaagttcccgcggttggggaatccatcacagaagcaaccatcggc
agttggactaaaaaatccggcgactttgtaaaacgcaatgaagttcttatgcttcttgag
actgacaaagccagcgtggaagttgtcgcggaaaacgacggtgttttgactatcaaccca
ggctgcgaagccggtgcggttgttcagatcggcgcgacagtggcgactcttgatacagac
gcaaaaccagctgcgggcgcagcagctcctgcggctgagactgcaaaggcagctgctcca
gcttccgcacctgccggtgctgcagctctgccggctgccgccgggaaagacgcttctgcg
cacttgtcccctgctgttaacagaatcgtaaatgaaaagggtctggacccttctgcgatc
caaggcacgggtaaagacggccgcctgactaaaggggacgttcttgaggcgcagccgggc
gcaaaacctgccgctccgaaagctgctccagcttccgcgccgaccggcgctccagcactg
cccgctgccgcgtccaagcagggcgacaaaaagcttgttccgatgacgaccatccgcaag
cgtatttccgaaaaactgaaagaagcgcaaaacacggcagctctactaaccactttcaac
gaagtggacatgggcaaggtgatggagcttcgttctaaatacaaagacaagttcaaagaa
aaatacggcgtgaacctgggcttcaacggcttcttcgtaaaagccgttgttgaggcactg
aaagacttccctgcagtcaacgcatggatcaacggcacagacatcgagtaccacaactac
tacaacatcggtattgcggtttccacagagaagggcttgatggttccgaacgtgaaagac
gcggatacactgtcccttgctggcattgaactggcgatccgtgatctggcggcaaaaggc
cgtgatggtaaaatcactccgaatgatctgggtggcggcaccttctctatcaccaatggt
ggtgtgttcggttctttgctttccacgccgattttgaacttcccgcagtcagctatcttg
ggccttcacaaaatccaggatcgtccaatggcgatcaacggaaaagtggaaatccgcccg
atgatgtatctggctttgacttacgatcaccgtatcatcgatggcaaagaggctgtgagc
ttccttgttaaaatcaaagaacttgtcgaagatcctgaaagattgcttctagaggtataa

DBGET integrated database retrieval system