KEGG   Bdellovibrio bacteriovorus HD100: Bd2813Help
Entry
Bd2813            CDS       T00159                                 

Gene name
adh
Definition
(GenBank) putative alcohol dehydrogenase I
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00010  Glycolysis / Gluconeogenesis
bba00071  Fatty acid degradation
bba00350  Tyrosine metabolism
bba00625  Chloroalkane and chloroalkene degradation
bba00626  Naphthalene degradation
bba01100  Metabolic pathways
bba01110  Biosynthesis of secondary metabolites
bba01120  Microbial metabolism in diverse environments
bba01130  Biosynthesis of antibiotics
bba01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bd2813 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Bd2813 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bd2813 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bd2813 (adh)
   00626 Naphthalene degradation
    Bd2813 (adh)
Enzymes [BR:bba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bd2813 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_11 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CAE80596
UniProt: Q6MJG4
Position
2721549..2722547
Genome map
AA seq 332 aa AA seqDB search
MFAARYVPGKKELSLVEVPKPTPGPLDVILKIRAAGICHSDLHVLHGEVPYKESFTMGHE
ACGEVVEKGSEVFGTFNPGDLYAVHGPNPCGHCNYCRTGHDNLCNDPSRTFIGLGQDGAY
AEYLKVPARNIVKVPKGISPEVAAVATDAVLTPYHAIKTKGGVGLGSKVLAIGLGGLGMN
GVQIALALGAEVTAVDLKDANLETAKSFGVQKVLNSKQISSLTPLSFDVVVDFVGLESTF
KDAQNFVKPGGTILLIGLGSAQVPLTTATAITFETKVQASFWGTHVEMQELYELIAEGKI
KPQVETAPMKEVNHWLHELEAGRVKSRMALIP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccgcaagatatgtccctggaaaaaaagaactttcattggtcgaagttcccaaa
cccacacccggcccactggatgtgattctgaaaattcgcgctgccggcatttgtcattcg
gacctgcacgtcttgcacggtgaggtgccttacaaagaaagcttcaccatgggccatgaa
gcctgcggcgaggtggtggaaaaaggctcggaagtcttcggcacttttaatcccggcgac
ctttacgctgttcacggaccgaatccatgcgggcattgcaactattgccgcactggtcat
gacaatctttgcaacgaccccagcagaacctttatcggtctgggacaagacggagcttat
gccgaatacctgaaggtccccgcccgcaacatcgtcaaagtccccaaaggtatcagccct
gaagtcgcggccgtcgccacggatgcggtgctaactccttatcatgccatcaaaacaaag
ggcggcgtgggcctgggatccaaagtgctggcgatcggcttgggtggcctgggaatgaac
ggcgttcaaatcgccctggctctgggggcggaagtcaccgccgtggatttaaaagacgcc
aatctggaaaccgcaaaatcttttggtgtgcaaaaggttttaaactccaaacagatctcg
tctttgacgccgctgtcttttgatgtggtggtggactttgtcggtcttgaatcgaccttc
aaggatgcccagaatttcgtaaaacccggcggcaccattttgctgataggcctgggatcc
gcccaagtgccactgacgacggccacggccatcacctttgaaacaaaagtgcaagcgtcc
ttctggggcactcacgtcgaaatgcaggagctttacgaactgatcgcggaaggtaaaatc
aaaccgcaggttgaaacagcaccgatgaaagaagtgaatcactggctgcacgagctggaa
gccgggcgagtcaaatcgcgcatggcattgattccgtaa

DBGET integrated database retrieval system