KEGG   Bdellovibrio bacteriovorus HD100: Bd2813Help
Entry
Bd2813            CDS       T00159                                 

Gene name
adh
Definition
alcohol dehydrogenase I (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bd2813 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bd2813 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Bd2813 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bd2813 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bd2813 (adh)
   00626 Naphthalene degradation
    Bd2813 (adh)
Enzymes [BR:bba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bd2813 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2721549..2722547
Genome map
AA seq 332 aa AA seqDB search
MFAARYVPGKKELSLVEVPKPTPGPLDVILKIRAAGICHSDLHVLHGEVPYKESFTMGHE
ACGEVVEKGSEVFGTFNPGDLYAVHGPNPCGHCNYCRTGHDNLCNDPSRTFIGLGQDGAY
AEYLKVPARNIVKVPKGISPEVAAVATDAVLTPYHAIKTKGGVGLGSKVLAIGLGGLGMN
GVQIALALGAEVTAVDLKDANLETAKSFGVQKVLNSKQISSLTPLSFDVVVDFVGLESTF
KDAQNFVKPGGTILLIGLGSAQVPLTTATAITFETKVQASFWGTHVEMQELYELIAEGKI
KPQVETAPMKEVNHWLHELEAGRVKSRMALIP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccgcaagatatgtccctggaaaaaaagaactttcattggtcgaagttcccaaa
cccacacccggcccactggatgtgattctgaaaattcgcgctgccggcatttgtcattcg
gacctgcacgtcttgcacggtgaggtgccttacaaagaaagcttcaccatgggccatgaa
gcctgcggcgaggtggtggaaaaaggctcggaagtcttcggcacttttaatcccggcgac
ctttacgctgttcacggaccgaatccatgcgggcattgcaactattgccgcactggtcat
gacaatctttgcaacgaccccagcagaacctttatcggtctgggacaagacggagcttat
gccgaatacctgaaggtccccgcccgcaacatcgtcaaagtccccaaaggtatcagccct
gaagtcgcggccgtcgccacggatgcggtgctaactccttatcatgccatcaaaacaaag
ggcggcgtgggcctgggatccaaagtgctggcgatcggcttgggtggcctgggaatgaac
ggcgttcaaatcgccctggctctgggggcggaagtcaccgccgtggatttaaaagacgcc
aatctggaaaccgcaaaatcttttggtgtgcaaaaggttttaaactccaaacagatctcg
tctttgacgccgctgtcttttgatgtggtggtggactttgtcggtcttgaatcgaccttc
aaggatgcccagaatttcgtaaaacccggcggcaccattttgctgataggcctgggatcc
gcccaagtgccactgacgacggccacggccatcacctttgaaacaaaagtgcaagcgtcc
ttctggggcactcacgtcgaaatgcaggagctttacgaactgatcgcggaaggtaaaatc
aaaccgcaggttgaaacagcaccgatgaaagaagtgaatcactggctgcacgagctggaa
gccgggcgagtcaaatcgcgcatggcattgattccgtaa

DBGET integrated database retrieval system