KEGG   Bdellovibrio bacteriovorus HD100: Bd3068Help
Entry
Bd3068            CDS       T00159                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bba01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bba01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2978004..2979110
Genome map
AA seq 368 aa AA seqDB search
MTNKRIEWPVALFLVLNPLITLILAPIYFYNFGFQWDILLFALVFAAATNLGITAGYHRL
FSHKSYDAHPIVKALFLLIGASAFQGSALKWSSDHRRHHTHIDGEKDPYNINEGFWYAHM
GWMFFKDSVDQKIHAPDLEKDWMVKFQNDHYVPIAILTGFIFPMLVGWAMGSWLGGLVIA
GGLRIALTQQSTFFINSLCHTLGKQTYSKEISARDSWFVAILTHGEGYHNFHHKFQIDYR
NGIKWYHWDPTKWVIRTLSAMGLATKLRQISNVEILKARLQAEAAELTKHGFAEEKLAQM
KEKILEAQNRMKKLREDYEQFKVDAVRKREELKEAYDHKLEELRRDMEIARLEFQMGMKQ
WRVYLRSV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaacgtatcgaatggccagtggccttgttcttagttctaaatccactgatc
acactcatcctggcccccatttatttctacaatttcggtttccaatgggacattcttctt
ttcgctttggtttttgcggcagcaaccaacctgggtatcactgcgggctatcaccgcttg
ttctcccataaaagctatgatgctcacccaattgtaaaagccctgttccttttgatcggt
gcttccgctttccagggttctgcattgaaatggtcttccgaccaccgtcgtcaccacacg
cacattgacggcgaaaaagatccttacaacatcaacgaaggtttctggtacgcccacatg
ggctggatgttcttcaaggactccgtggatcagaaaatccacgctccggatcttgaaaaa
gactggatggtgaaattccagaacgatcactatgttcccattgcgatcctgactggattc
atcttcccgatgctggtgggctgggcgatgggttcctggttgggtggtctagtgatcgca
gggggcctgcgcattgctctgactcaacagtcgactttcttcatcaactctctttgccac
actttgggtaaacagacttattccaaagaaatttctgcccgtgactcctggttcgtggcg
attctgactcatggtgagggttaccataacttccaccacaagttccagatcgactaccgc
aacgggatcaaatggtaccactgggatccgactaaatgggtgatccgtactttgagtgcc
atgggtcttgcgaccaaactgcgccagatctctaatgttgagattctgaaagcccgcctg
caggcggaagcggccgagctgaccaaacacggttttgctgaagaaaagctggctcagatg
aaagagaaaatcctggaagcgcagaacagaatgaagaagctgcgtgaggactatgaacag
ttcaaagtggatgccgttcgcaaacgtgaagagctgaaagaggcttacgaccacaagctg
gaagaacttcgccgtgacatggaaattgccagactggaattccagatgggcatgaaacaa
tggcgcgtgtatctgcgctctgtctag

DBGET integrated database retrieval system