KEGG   Bdellovibrio bacteriovorus HD100: Bd3231Help
Entry
Bd3231            CDS       T00159                                 

Gene name
folA
Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bba00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bba00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3148800..3149309
Genome map
AA seq 169 aa AA seqDB search
MILTHVVACSQNRVIGAQGGLPWSLPEDMKFFRETTKGHIMIMGRKTFDSFNGRALPNRY
HIVVTRDPSKQSFNSTESSPVVFVASIEEAVKHAEPLTAKWGDEVFIIGGGEIYKQAMPI
TDKIYLTLIHREFPGDTYYPEIDEKVFTQTERRDIETPIPFSFLTYLRK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgattttgactcatgtggtggcctgttcgcagaaccgtgtgattggcgcgcaagggggc
cttccctggagtctgcccgaggacatgaagttcttccgcgaaaccaccaagggtcatatc
atgatcatggggcgcaagacgtttgattctttcaacggccgcgcccttcccaaccgctac
cacatagtggtgacacgcgacccgtccaaacaaagcttcaactccaccgaatccagcccc
gtggttttcgttgcttccatcgaagaagcggtgaaacacgccgaacctttgactgcaaaa
tggggcgacgaggttttcattattggcggcggcgaaatctacaaacaggcaatgccgatc
acggacaaaatctatctgacgctgatccaccgcgagtttccgggggacacttattaccct
gaaattgacgaaaaggtgttcactcagactgagcgacgtgacatcgaaacgcctattcct
ttttcgtttctgacttacttgcgcaagtag

DBGET integrated database retrieval system