KEGG   Bdellovibrio bacteriovorus HD100: Bd3384Help
Entry
Bd3384            CDS       T00159                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bd3384
   01230 Biosynthesis of amino acids
    Bd3384
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bd3384
   00030 Pentose phosphate pathway
    Bd3384
   00051 Fructose and mannose metabolism
    Bd3384
   00052 Galactose metabolism
    Bd3384
  Energy metabolism
   00680 Methane metabolism
    Bd3384
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Bd3384
Enzymes [BR:bba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bd3384
Protein phosphatases and associated proteins [BR:bba01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Bd3384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3291387..3292376
Genome map
AA seq 329 aa AA seqDB search
MAQFDKKIQKIGVYTSGGDAPGMNAAIRAVVRVGISQKLEVYGIHNGYVGMIENKIEPLQ
LRDMANIIQRGGTILKTGRSTEFMRPEGRARAAQNIKNLGLDALVCIGGDGSFRGAHALW
EEHQIPVVGVPGTIDNDIFGSDKTIGFDTAVNTALEAIDRIRDTAASHDRLFIVEVMGRN
SGFIASHVGLAGGAEEIFTPDANTTVEKAIDRINEAKSRGKTSSIIITAEGQKPGRAYDL
ADAIRKKSGMDAKVCILGHQQRGGSPTAADRILASRMGAAAVDALFKGYCDVMIGTEGER
LIQVPLDLVYKNEKKNQLDLISLASVLAT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtttgataagaaaattcagaaaattggtgtgtacacaagcggcggcgatgcc
ccgggtatgaatgcggcaatccgcgcagtggtgcgtgtggggatctcgcaaaaacttgaa
gtgtacggaattcataatggctatgttggcatgatcgaaaacaagatcgagcctttgcaa
ttgcgtgacatggccaacatcatccagcgcggcggtacaatcctgaaaaccggtcgctcc
actgaattcatgcgccccgaaggccgggcccgtgccgctcagaatatcaaaaatttggga
cttgatgccctggtctgcatcggtggtgatggctccttccgtggtgctcacgccctttgg
gaagaacatcagatccccgtcgtcggcgttcccggcaccatcgacaatgacatcttcggc
agcgacaaaaccatcggctttgatacggctgtgaacacagctcttgaagcaattgaccgc
attcgtgacaccgccgcctctcacgaccgtttgttcatcgttgaagtgatgggcagaaac
tcgggcttcatcgcctctcacgtgggccttgcgggtggcgcggaagaaatcttcactccg
gatgccaacaccactgttgaaaaagccatcgaccgcatcaacgaagccaaatcccgcggc
aaaaccagcagcatcatcatcaccgctgaaggacagaaaccgggacgcgcgtatgatctg
gccgatgccatccgcaaaaaatccggtatggacgcaaaagtttgtattcttggacaccaa
caacgtggtggctccccgacagcggccgaccgtattcttgccagccgcatgggtgctgct
gccgtggatgctttgttcaaagggtattgcgacgtcatgatcggcacggaaggtgaacga
cttattcaggtgcctttggacctcgtgtacaagaatgaaaagaaaaaccagttggatctg
atctcgctggcgagtgttctggcaacttaa

DBGET integrated database retrieval system