KEGG   Bdellovibrio bacteriovorus HD100: Bd3653Help
Entry
Bd3653            CDS       T00159                                 

Gene name
ybaA
Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bba00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bba00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bba02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3545273..3545632)
Genome map
AA seq 119 aa AA seqDB search
MAKYVDGFVLTVPKKNMAQYRKMAMQASKIFLKHGALEYKECVGDDMNIDWALPFPKLTK
AKSDEVIVFSWITYKSRAARDRANKAMMNDPKMKEMSPDKMPFNMKRMAYGGFKTIVDK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatacgttgatggatttgtactgactgttcccaaaaaaaacatggcgcagtat
cgcaagatggcgatgcaggcctcaaaaatatttttgaagcacggagccctggaatacaag
gaatgtgtcggggatgacatgaatatcgattgggcgctgccgtttccaaagctgaccaag
gcgaaatccgatgaagtgattgtgttttcctggatcacttacaaatcccgtgctgcccgg
gatcgcgccaacaaagcgatgatgaacgatccgaaaatgaaagaaatgagtccggacaag
atgccattcaatatgaagcgcatggcctacggtggattcaaaacgatcgtggacaagtag

DBGET integrated database retrieval system