KEGG   Bdellovibrio bacteriovorus HD100: Bd3653Help
Entry
Bd3653            CDS       T00159                                 

Gene name
ybaA
Definition
(GenBank) hypothetical protein
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Bd3653 (ybaA)
   00790 Folate biosynthesis
    Bd3653 (ybaA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Bd3653 (ybaA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bd3653 (ybaA)
Enzymes [BR:bba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Bd3653 (ybaA)
Exosome [BR:bba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bd3653 (ybaA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bba00537]
 Enzymes
  Bd3653 (ybaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3545273..3545632)
Genome map
AA seq 119 aa AA seqDB search
MAKYVDGFVLTVPKKNMAQYRKMAMQASKIFLKHGALEYKECVGDDMNIDWALPFPKLTK
AKSDEVIVFSWITYKSRAARDRANKAMMNDPKMKEMSPDKMPFNMKRMAYGGFKTIVDK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatacgttgatggatttgtactgactgttcccaaaaaaaacatggcgcagtat
cgcaagatggcgatgcaggcctcaaaaatatttttgaagcacggagccctggaatacaag
gaatgtgtcggggatgacatgaatatcgattgggcgctgccgtttccaaagctgaccaag
gcgaaatccgatgaagtgattgtgttttcctggatcacttacaaatcccgtgctgcccgg
gatcgcgccaacaaagcgatgatgaacgatccgaaaatgaaagaaatgagtccggacaag
atgccattcaatatgaagcgcatggcctacggtggattcaaaacgatcgtggacaagtag

DBGET integrated database retrieval system