KEGG   Bdellovibrio bacteriovorus HD100: Bd3733Help
Entry
Bd3733            CDS       T00159                                 

Gene name
recR
Definition
DNA repair and genetic recombination protein
Orthology
K06187  
recombination protein RecR
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bd3733 (recR)
DNA repair and recombination proteins [BR:bba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bd3733 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3609364..3609978
Genome map
AA seq 204 aa AA seqDB search
MLHISALEKLVHELSRLPGIGPKTAQRLAYYILRTGNEYPERLSEALLRVKAEVHDCPTC
FNYTDTDICRYCEDSHRSDESICVVEEPSDIMRIESSGAFRGRYHVLHGAISPLEGIGPK
ELKIKELIDRVEDGLSGTGPAIKEIILALDADLEGDTTILYLAKQLQGKGLKLSRIAHGV
PIGSDIDFVDDRTMGRALQNRVEL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgttacatatttctgcccttgaaaaattagtccacgagttgagccgtctgcctggtatc
gggccgaagactgctcagcgtctggcttattacattctgcgcaccgggaacgaatacccg
gagcgtttgagtgaggcgcttttgcgcgtcaaggctgaagttcacgactgcccaacctgc
ttcaactacaccgacacggatatctgccgctattgtgaggattctcaccgttcggatgaa
tccatctgtgtggttgaagaaccctccgacatcatgagaattgaatcttcgggcgcattc
cgtggccgctaccatgttttgcatggggcgatttccccactggaaggcatcggtcccaaa
gaattgaaaatcaaagagctgatcgaccgtgttgaagacggtttgagcggcacaggtcct
gcgatcaaggaaatcatccttgcattggatgcagaccttgagggcgacaccaccattttg
tacctggcaaagcagctgcagggcaaaggcttgaaactttctcgcattgcccatggagtt
cctattggcagcgacatcgatttcgtagatgatagaacgatgggtcgcgccctgcaaaac
cgcgtggagctgtaa

DBGET integrated database retrieval system