KEGG   Bdellovibrio bacteriovorus HD100: Bd3773Help
Entry
Bd3773            CDS       T00159                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bd3773 (galF)
   00052 Galactose metabolism
    Bd3773 (galF)
   00500 Starch and sucrose metabolism
    Bd3773 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    Bd3773 (galF)
Enzymes [BR:bba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bd3773 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3647227..3648111
Genome map
AA seq 294 aa AA seqDB search
MPRVKKAIIPAAGLGTRFLPATKTVPKEMLTIVDAPIILYVVEEAVKAGIEDIILIAGRG
KHAIEDFFDTSYELEDKLAKDGKEKLLERVTRIRDSANIISIRQKQAMGLGHAVLCGLPI
VGKEPFAVLLGDEITMGFHGEPNVTSQLVSSFEETGTSTISVMKVEDKDVSKYGIAEIEE
KSTGFFKVTSLVEKPKASETNSRWALPGRYVFDNAIMDILQNAKPTLNGEIQLTDSMKVL
CAQHGLNAMTFTAQRFDAGDKLGYLQANIELALQSPELNQELKSYILSLAEKLK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagttaaaaaagccattatccccgctgccggcctcggaacccgtttcctgcct
gccaccaagactgtcccgaaagaaatgctgaccatcgtggacgctccaatcattctgtat
gtggtggaagaagccgtgaaagccgggatcgaggacatcatcctgatcgccggacgtggc
aaacatgccatcgaggacttctttgacacttcttacgagttagaagacaaactggccaaa
gacggcaaagaaaaactgctggagcgtgtgacccgcatccgtgattccgcgaacatcatc
agcatccgccaaaaacaagccatgggcttgggccacgctgtgctgtgcgggcttccgatt
gtgggtaaagagccgtttgcggttcttctgggggatgaaatcaccatgggcttccacggg
gaaccgaacgtgacttcccagctggtcagctcttttgaggaaaccgggacttccaccatt
tcggtgatgaaggtcgaagacaaagacgtctccaagtacggcattgccgaaatcgaggaa
aaatccacgggcttcttcaaagtgacttctttggtggaaaaacccaaagccagtgaaacc
aacagccgctgggctcttccgggtcgttatgtttttgacaatgcgatcatggatattctg
caaaatgcaaaaccaaccctgaatggtgaaatccaactgactgacagcatgaaggtgctt
tgtgcccagcacggtctgaacgccatgacattcaccgctcaacgttttgatgccggcgac
aagctgggttacctgcaggccaatatcgagctggccctgcaaagtccggagctgaatcag
gaattgaagtcctacatcctcagcctggccgaaaaactgaagtaa

DBGET integrated database retrieval system