KEGG   Bdellovibrio bacteriovorus HD100: Bd3810Help
Entry
Bd3810            CDS       T00159                                 

Gene name
sucC
Definition
succinyl-CoA synthetase beta chain (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bd3810 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bd3810 (sucC)
   00640 Propanoate metabolism
    Bd3810 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Bd3810 (sucC)
Enzymes [BR:bba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bd3810 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3675791..3676954
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKEVLRKFGVATLKGKLAHSPEEAVAAAKEIGGSVWVVKAQIHAGGRGKGGGV
KVAKSLDEVSEFTKKMIGMTLVTHQTGPEGKVVQKVFIEQGCNIAKEYYVACLIDRATGR
AAMMASSEGGMDIEEVAEHNPDAIKKVDIDPTVGLMPFQARELAFQIGMEPAIVNKAVKF
FAGLYNAFVATDCSIAEINPLVVTKEGDVLCLDAKMNFDSNSLFRHPDIVEMRDLNEEEP
SEIEASKFDLAFIKLDGNIGCLVNGAGLAMATLDIIKLHGAEPANFLDVGGGANKEKVTE
AFKIILKDKNVKGILVNIFGGIMKCDIIAEGVIAASKELGLKVPLVVRLEGTNVELGKKM
LKESGLNITPADNLTDAAKKIVAAIKG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcaggctaaagaagtcttgagaaagttcggagtggctacgctg
aaaggcaaacttgctcactctcctgaagaagctgttgctgcggcaaaagaaatcggcgga
agcgtttgggttgtaaaagcccagatccacgctggtggtcgcggtaaaggtggcggtgtt
aaagttgccaagtctctggacgaggtttctgaattcaccaagaaaatgatcggcatgact
ttggtgactcaccaaacaggccctgaaggcaaagttgttcaaaaagtcttcatcgaacaa
ggctgcaacatcgcaaaagaatactatgttgcctgcttgatcgaccgtgcgacaggccgt
gcggctatgatggcatcttccgaaggtggtatggacatcgaggaagttgctgaacacaat
ccagacgcgatcaaaaaagtcgacatcgacccaactgtgggcttgatgccgttccaggct
cgcgaactggctttccaaattggtatggaaccagcgatcgtgaacaaagcggtgaaattc
ttcgccggtctttacaacgcattcgttgctacggactgctctatcgcggaaatcaaccca
ttggttgtgactaaagaaggcgacgttctttgcttggatgcgaaaatgaacttcgactcc
aactctttgttccgtcatccagacatcgtagagatgcgcgacctgaacgaagaagaaccg
tctgaaatcgaagcttccaaattcgacctggcgttcatcaagcttgatggtaacatcggc
tgccttgtgaacggtgcgggtctggcgatggcgactttggacatcatcaaattgcacggt
gctgagcctgcaaacttcctggatgttggcggcggcgctaacaaagagaaagtgactgaa
gcgttcaaaatcatcctgaaagacaaaaacgtaaaagggatcctggttaacatcttcggt
ggtatcatgaaatgtgacatcatcgcggaaggtgtgatcgcggcgtccaaagaattgggc
ctgaaagttccattggttgttcgccttgaaggtacaaacgtggaattgggtaaaaagatg
ttgaaagaatctggtttgaacatcactccagccgacaacctgactgatgcagctaaaaag
atcgttgctgcgattaaaggataa

DBGET integrated database retrieval system