KEGG   Bdellovibrio bacteriovorus HD100: Bd3895Help
Entry
Bd3895            CDS       T00159                                 

Definition
Beta-hexosamidase A precursor (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bd3895
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Bd3895
Enzymes [BR:bba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bd3895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3765298..3766974
Genome map
AA seq 558 aa AA seqDB search
MNKYIRGILRNFSFCLLILVFPNLVLASGPSANKLSKVIDSKIKQMSPEEKVGQLFIVGF
PHKDVAPDLESFIAKYKPGSFLLFKRNMISAPQIRELNLALYKSSYKHSKLPPLIAIDQE
GGSVSRLPITPAPPNALALGQTQSPLLAEEMGYQTGLFLREVGFNMNLAPVLDVVDPYST
SFIGVRSFGSDPELVRDIGVAYSKGLLKARVIPTAKHFPGTGSLNQDPHLTIVKNSASLE
EMKKRDLIPFTGYSKIGANIAVMMSHLIYPGLDEDLEPASFSTKISKTLLRDELKYQGLV
MTDDLQMQGSKQVLRPEAAALRALQSGSDIVMLTWSFADQGKAFDYVLAALKSGELPSAH
VDEKLRRILRVKAFANVYRRDPKLPSMLSGNSLTSPQYAEVEDEVLSQNLKTSLIPRQLP
SVRSARKPASVETVCAASPSQDFLLSFVGAEKKKIPVLKLENSSQGKDLSALLKKKQCTA
LFVGVTGPRTARQVRGLSPQERQKLIVVNLGAPRLFPKSRGYRQVIQLYFNHKDAGRKIA
QYRDEILKSSQGSFALKD
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagtatatcaggggaatccttaggaattttagtttttgtctgctgattcttgtt
tttcccaaccttgtactagcttctggtccttcggctaataagctgtcaaaagtcatcgat
tccaaaatcaaacaaatgagccccgaagagaaagtcggacaacttttcatcgttggcttt
ccccataaagacgtcgctccggatctggaatcctttatcgcgaaatacaaacccggatcc
ttcctgctctttaagcgcaacatgatttcagccccgcagattcgtgaactgaatctggct
ctttataaatccagctacaaacattccaaacttccaccactgattgccatcgatcaggaa
gggggatcggtttcccgcttaccgatcacgccagcgccgccgaatgctttggctttgggg
caaacccagtccccgcttttggcggaggaaatgggttatcagacaggactgttcctgcgc
gaagtgggctttaacatgaatctggcgcccgtgctggatgtggtggatccctattcaact
agcttcattggtgttagatcctttggttctgatccggaactggtgcgcgacattggggtc
gcgtattcgaaagggcttctgaaagcgcgggtcattcccacggcgaaacattttcccggc
accggcagtctgaaccaggatccgcatctgacgatcgtgaaaaacagtgcgtccttggaa
gaaatgaaaaagcgcgatctgattccatttacaggttattcgaagatcggcgccaatatc
gcggtgatgatgtcccatctgatttacccgggtcttgatgaagatctggaacccgccagt
ttctccaccaagatttccaaaactcttttgcgtgacgaactgaagtatcagggccttgtt
atgaccgatgatctgcagatgcaaggatccaagcaagtgctgcgccctgaggccgcggcc
ctgcgcgccctgcaatccgggtcagacattgtgatgctgacatggtcttttgcggatcaa
gggaaggcttttgactatgtcttagcggcgctgaaatccggggagcttccttcggcccat
gtggatgaaaaactgcgccggattttgcgcgtaaaggcctttgcgaatgtctatcgccgc
gaccccaagcttccgtccatgttgagtggcaacagcctcacctctcctcaatatgccgag
gtggaagatgaagtcctgtcccagaatttaaaaaccagcctgatcccacgacagctacca
tcagtaagatccgcccgcaagccggcgtcggttgaaaccgtctgtgcggcctcaccgtct
caggatttcctgctgtccttcgtgggtgctgaaaagaaaaagattccggttctgaagctt
gaaaacagctcccagggtaaggatctgtcagctttgctgaagaaaaaacagtgcaccgct
ttgtttgtgggagtcaccggtccccgcacggcccgtcaggtgcgcggtctttccccacag
gaacgtcaaaagctgattgttgtgaacttgggggctcctcgcctgtttccgaaatcgcgc
ggctaccgccaggtgattcagctttacttcaatcacaaggatgcaggaagaaagatcgcc
cagtaccgggatgagatcttaaaaagttctcaaggctcgtttgctctgaaagattag

DBGET integrated database retrieval system