KEGG   Bdellovibrio bacteriovorus 109J: EP01_00655Help
Entry
EP01_00655        CDS       T03079                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bbac  Bdellovibrio bacteriovorus 109J
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bbac00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    EP01_00655
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    EP01_00655
Enzymes [BR:bbac01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     EP01_00655
Lipid biosynthesis proteins [BR:bbac01004]
 Desaturase
  First
   EP01_00655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
133514..134620
Genome map
AA seq 368 aa AA seqDB search
MTNKRIEWPVALFLVLNPLITLILAPIYFYNFGFQWDILLFALVFAAATNLGITAGYHRL
FSHKSYDAHPIVKALFLLIGASAFQGSALKWSSDHRRHHTHIDGEKDPYNINEGFWYAHM
GWMFFKDSVDQKIHAPDLEKDWMVKFQNDHYVPIAILTGFIFPMLVGWAMGSWLGGLVIA
GGLRIALTQQSTFFINSLCHTLGKQTYSKEISARDSWFVAILTHGEGYHNFHHKFQIDYR
NGIKWYHWDPTKWVIRTLSAMGLATKLRQISNVEILKARLQAEAAELTKHGFAEEKLAQM
KEKILEAQNRMKKLREDYEQFKVDAVRKREELKEAYDHKLEELRRDMEIARLEFQMGMKQ
WRVYLRSV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaacgtatcgaatggccagtggccttgttcttggttctaaatccactgatc
acactcatcctggcccccatttatttctacaatttcggtttccaatgggacattcttctt
ttcgctttggtttttgcggcagcaaccaacctgggtatcactgcgggctatcaccgcttg
ttctcccataaaagctatgatgctcacccaattgtaaaagccctgttccttttgatcggt
gcttccgctttccagggttctgcattgaaatggtcttccgaccaccgtcgtcaccacacg
cacattgacggcgaaaaagatccttacaacatcaacgaaggtttctggtacgcccacatg
ggctggatgttcttcaaggactccgtggatcagaaaatccacgctccggatcttgaaaaa
gactggatggtgaaattccagaacgatcactatgttcccattgcgatcctgactggattc
atcttcccgatgctggtgggctgggcgatgggttcctggttgggtggtctggtgatcgca
gggggcctgcgcattgctctgactcaacagtcgactttcttcatcaactctctttgccac
actttgggcaaacagacttattccaaagaaatttctgcccgtgactcctggttcgtggcg
attctgactcatggtgagggttaccataacttccaccacaagttccagatcgactaccgc
aacgggatcaaatggtaccactgggatccgactaaatgggtgatccgtactttgagtgcc
atgggtcttgcgaccaaactgcgccagatctctaatgttgagattctgaaagcccgcctg
caggcggaagcggccgagctgaccaaacacggttttgctgaagaaaagctggctcagatg
aaagagaaaatcctggaagcgcagaacagaatgaagaagctgcgtgaggactatgaacag
ttcaaggtggatgccgttcgcaaacgtgaagaactgaaagaggcttacgaccacaagctg
gaagaacttcgccgtgacatggaaattgccagactggaattccagatgggcatgaaacaa
tggcgcgtgtatctgcgctctgtctag

DBGET integrated database retrieval system