KEGG   Bdellovibrio bacteriovorus 109J: EP01_08715Help
Entry
EP01_08715        CDS       T03079                                 

Definition
phosphodiesterase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bbac  Bdellovibrio bacteriovorus 109J
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bbac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EP01_08715
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    EP01_08715
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EP01_08715
Enzymes [BR:bbac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     EP01_08715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1814382..1815440
Genome map
AA seq 352 aa AA seqDB search
MILLALALSACTHKTPDKATHVQHLATTYVSTLPSRGIDYSAKIERVAFGSCANQDEPQP
IWNTIAATHPDLFLFTGDNIYGSWSGQQPLAEQYRKLDLLPEYRAVREKVPFMATWDDHD
FGQRDGGQDWTGKDAARRDFMNYWTYTRNSMPLEQGGVYHSKIIGPKKQMVQVIMLDTRY
YRSPLKERPGFEGKAMNYIPQDEGTILGEPQWEWFEAQLKRPADVRFIVSSIQLIADDPQ
FEKWGNFPKERQRFFDLIKSTRAKNVIVISGDRHIASIAKTDLKGYGPLYDITASSLNRP
NKYPDADSHYVGLTYNQENFGLAEIDWKKKTVAMQIRSMENKIVNSIEIKLK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgattctgctggcgctggctctttctgcctgcactcacaagaccccggacaaagccacc
catgttcagcatctggccaccacctacgtgtccaccctgccgtctcggggcatcgactat
tctgcgaaaatagaacgtgtggcctttggctcctgcgccaatcaggacgaaccccaaccg
atctggaacaccatcgcggccacccacccggatctgttcctgttcaccggagacaacatc
tatggcagctggtccggtcagcaacccctcgccgaacaatatcgcaagctggatctgctt
cccgaatatcgtgccgttcgcgaaaaggttcctttcatggccacctgggatgatcatgac
tttggccagcgtgacggcggccaggattggaccggcaaagatgccgcccgtcgtgatttt
atgaactattggacctacacccgcaacagcatgccgctggagcaagggggcgtttatcac
agcaaaatcatcggaccgaaaaaacaaatggttcaggtgattatgctcgacactcgttat
taccgcagccccttaaaagaacgcccgggctttgaaggcaaagcgatgaactatatccct
caggatgaaggcaccatactgggcgagccgcaatgggagtggtttgaagcccaactgaaa
cggccggccgatgtgcgctttatcgtcagcagcattcagctgattgccgatgacccgcaa
tttgaaaaatgggggaacttcccgaaagaacgtcaaagattctttgatctgataaaatcc
acccgcgccaagaatgtgatcgtcatcagcggcgaccgtcatatcgcctccatcgccaaa
acagatctgaagggttatggcccgctttacgatatcactgccagctctctgaatcgtccg
aataaatacccggacgccgacagtcactatgtgggcttgacctacaatcaggaaaacttc
ggcctggcagaaattgactggaaaaagaaaaccgtcgccatgcagattcgcagcatggaa
aataaaattgtaaactcaatcgaaatcaaactgaagtaa

DBGET integrated database retrieval system