KEGG   Burkholderiales bacterium GJ-E10: E1O_22700Help
Entry
E1O_22700         CDS       T03654                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00071  Fatty acid degradation
bbag00280  Valine, leucine and isoleucine degradation
bbag00310  Lysine degradation
bbag00362  Benzoate degradation
bbag00380  Tryptophan metabolism
bbag00620  Pyruvate metabolism
bbag00630  Glyoxylate and dicarboxylate metabolism
bbag00640  Propanoate metabolism
bbag00650  Butanoate metabolism
bbag00900  Terpenoid backbone biosynthesis
bbag01100  Metabolic pathways
bbag01110  Biosynthesis of secondary metabolites
bbag01120  Microbial metabolism in diverse environments
bbag01130  Biosynthesis of antibiotics
bbag01200  Carbon metabolism
bbag01212  Fatty acid metabolism
bbag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbag00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    E1O_22700
   00630 Glyoxylate and dicarboxylate metabolism
    E1O_22700
   00640 Propanoate metabolism
    E1O_22700
   00650 Butanoate metabolism
    E1O_22700
  Lipid metabolism
   00071 Fatty acid degradation
    E1O_22700
   00072 Synthesis and degradation of ketone bodies
    E1O_22700
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    E1O_22700
   00310 Lysine degradation
    E1O_22700
   00380 Tryptophan metabolism
    E1O_22700
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    E1O_22700
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    E1O_22700
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    E1O_22700
Enzymes [BR:bbag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     E1O_22700
Exosome [BR:bbag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   E1O_22700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAP89401
UniProt: A0A0A1H4Z9
Position
complement(2411489..2412694)
Genome map
AA seq 401 aa AA seqDB search
MTEIVILSAVRTPIGKFGGSLARHAAVDLGAIVVREALARARIAPDAVDEVILGQVLTAG
AGQNPARQAAVRAGVPVQVPAMTVNQVCGSGLRAVMLAAQAVANGDARVVVAGGQESMSR
APHLLAGARDGIRMGDATLLDSMIRDGLWDAFDDVHMGITAENVAREHGISRAMQDEFAA
ASQRKAAAAQQAGRFRDEIVAVPLPQKKGEPVVPFAEDETIRPATTTETLARLRPAFDPD
GTVTAGNASGINDGAAAVVVTTAEYAREIGAPVLARIAGFAAAGVEPRVMGMGPVPAVRR
ALAKTGWRAQDLDLLEINEAFAAQACAVNREMDWDPARVNVNGGAIALGHPIGASGCRIL
VTLLHEMARQNATRGVTRGAQRGLASLCVGGGMGVALAVER
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatcgtgattctctccgccgtccgcactcccatcgggaagttcggtggcagc
ctcgcccggcatgccgccgtggatctcggcgcgatcgtcgtgcgcgaagcgctcgcccgc
gcgcggatcgctcccgacgcggtcgacgaagtgatcctcggccaggtgctcaccgccggc
gcggggcagaacccggcgcggcaggcggcggtgcgcgccggcgtgccggtgcaggttccc
gccatgacggtcaaccaggtctgcggcagcggcctgcgcgccgtgatgctcgccgcgcag
gccgtcgccaacggcgatgcgcgcgtggtcgtggccggcggccaggagagcatgagtcgg
gcgccgcacctgctcgccggcgcgcgcgacggcattcggatgggggacgccacgctcctc
gacagcatgatccgcgacggcctctgggacgcgttcgacgacgtgcacatgggcatcacc
gcggaaaacgtcgcccgcgaacacggcatctcgcgcgcgatgcaggacgaattcgctgcc
gcctcgcagcgcaaggcggccgccgcgcagcaggccggccgcttccgcgacgagatcgtc
gcggtgccgctgccgcagaagaagggcgagccggtggtgccgttcgccgaggacgaaacc
atccgcccggccacgacgaccgaaacccttgcccgcctgcgccccgcgttcgaccccgac
ggcaccgtcaccgcgggcaacgcctcgggcatcaacgacggcgccgccgccgtggtcgtc
acgaccgcggagtacgcccgcgaaatcggcgcgccggtgctcgcccgcatcgccggcttc
gccgccgccggcgtggagccgcgcgtgatgggcatgggtcccgtgcccgccgtgcgccgc
gcattggcgaagaccggctggcgcgcgcaggacctcgacctgctcgagatcaacgaagcc
ttcgccgcccaggcctgcgcggtgaatcgcgaaatggactgggaccccgcccgggtcaac
gtcaacggcggcgcgatcgccctcggccaccccatcggtgcctccggctgccggatcctc
gtcacgctgctgcatgaaatggcgcggcagaatgccacccgcggtgtgacccgcggcgcc
cagcgcggccttgcctccctctgcgtcggcggcggcatgggggtcgcattggcggtggag
cggtag

DBGET integrated database retrieval system