KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_0014Help
Entry
Bdt_0014          CDS       T02356                                 

Gene name
pmm
Definition
hypothetical protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bdt_0014 (pmm)
   00030 Pentose phosphate pathway
    Bdt_0014 (pmm)
   00051 Fructose and mannose metabolism
    Bdt_0014 (pmm)
   00052 Galactose metabolism
    Bdt_0014 (pmm)
   00500 Starch and sucrose metabolism
    Bdt_0014 (pmm)
   00520 Amino sugar and nucleotide sugar metabolism
    Bdt_0014 (pmm)
  Nucleotide metabolism
   00230 Purine metabolism
    Bdt_0014 (pmm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bdt_0014 (pmm)
Enzymes [BR:bbat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bdt_0014 (pmm)
    5.4.2.8  phosphomannomutase
     Bdt_0014 (pmm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(14022..15389)
Genome map
AA seq 455 aa AA seqDB search
MFQPVIFREYDIRGVYNGQFDDNFAYLLGRAYVVYMKQNKNITNPTVALGCDARESSPAI
IKNLAKGLMDSGANVIHLGLVTTPVCYFATFELKVDGAVQVTGSHNPPEYNGFKISVGKG
TIFGVEIQKLLHIIQKGEFIDGQGSEESFDIKPMYYARYAKEFGHIKDTKVVLDCGNGAG
GSVVRGLFEACGLKPTILFEQPDGTFPNHHPDPTVEENLVDLKAQVLKEGAVAGIGFDGD
ADRIGVVDHTGRMVYGDELMVIISRAILAEQKGAKIIGDVKCSDRLYHDVAKHGGQPIMW
KTGHSLVKEKIKVEKAPFGGEMSGHVFFADRNHGYDDAPYAALRLVEILAKTGKTIPQLL
EGLPPSFNTPEIRIDTTEEKKVLIVEKMIEAFPAKEGADYKVDFTDGIRLSFADGWALCR
SSNTQPVVVVRYESSSQAGLDAIRNRVEAIVNKYL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaacccgtcatttttagagaatacgacattcgcggcgtctataacggacagttc
gacgacaactttgcttacctgctgggtcgcgcttacgtcgtttacatgaaacaaaacaag
aacatcactaatccaaccgtggcgttgggctgtgatgcgcgtgaaagctctccggccatc
atcaagaatcttgcaaaaggtctgatggattcaggcgcgaacgttattcacctgggtctg
gtaaccacgccggtttgttacttcgccacgtttgaattgaaagtcgatggcgcggttcag
gtaactggttcgcacaatcctccagaatacaacggctttaaaatttctgtgggtaaaggc
accatctttggcgtcgaaatccagaaacttttgcacatcattcaaaaaggcgaattcatt
gacggtcagggttcagaagaatctttcgacatcaagccaatgtactacgcacgttacgct
aaagaattcggccacatcaaagacaccaaagttgttttggactgcggtaacggtgctggc
ggatctgtggtgcgcggcttgtttgaagcctgcggtttgaaacccaccattttgtttgaa
cagccagatggcacattcccgaatcaccacccggatccaacggttgaagaaaacctggtg
gaccttaaggcccaggttcttaaagagggcgccgtggcgggcatcggctttgacggcgat
gccgaccgtatcggtgttgtcgatcacacgggccgcatggtttacggtgatgaattgatg
gtgatcatttcccgcgcgattttggctgaacaaaaaggggctaagatcattggcgatgtg
aagtgctctgatcgtctgtaccacgatgttgccaaacacggtggtcagccaatcatgtgg
aaaaccggacactctttggtgaaagaaaaaatcaaagttgaaaaagcgccattcggtggc
gagatgtccggtcacgtgttctttgccgaccgcaatcacggttacgatgatgctccttac
gcagctttgcgtttggtggaaatcctggcaaaaaccggcaaaacaattccacagttgctg
gaaggtttgcctccgtctttcaacactccagaaatccgcatcgacaccactgaagaaaag
aaggttctgatcgttgaaaaaatgattgaagctttcccggctaaagagggtgctgattat
aaagtggactttacggatggtatccgcctgagctttgctgacggctgggcactgtgccgc
tcttccaacacacagccagtggtggtggttcgttacgaatcctcgtcccaggcggggctg
gatgcgatccgcaaccgcgttgaagccatcgtaaacaagtatctttaa

DBGET integrated database retrieval system