KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_0014Help
Entry
Bdt_0014          CDS       T02356                                 

Gene name
pmm
Definition
(GenBank) hypothetical protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
bbat00010  Glycolysis / Gluconeogenesis
bbat00030  Pentose phosphate pathway
bbat00051  Fructose and mannose metabolism
bbat00052  Galactose metabolism
bbat00230  Purine metabolism
bbat00500  Starch and sucrose metabolism
bbat00520  Amino sugar and nucleotide sugar metabolism
bbat00521  Streptomycin biosynthesis
bbat01100  Metabolic pathways
bbat01110  Biosynthesis of secondary metabolites
bbat01120  Microbial metabolism in diverse environments
bbat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bdt_0014 (pmm)
   00030 Pentose phosphate pathway
    Bdt_0014 (pmm)
   00051 Fructose and mannose metabolism
    Bdt_0014 (pmm)
   00052 Galactose metabolism
    Bdt_0014 (pmm)
   00500 Starch and sucrose metabolism
    Bdt_0014 (pmm)
   00520 Amino sugar and nucleotide sugar metabolism
    Bdt_0014 (pmm)
  Nucleotide metabolism
   00230 Purine metabolism
    Bdt_0014 (pmm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bdt_0014 (pmm)
Enzymes [BR:bbat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bdt_0014 (pmm)
    5.4.2.8  phosphomannomutase
     Bdt_0014 (pmm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFX99727
UniProt: K7YQ89
Position
complement(14022..15389)
Genome map
AA seq 455 aa AA seqDB search
MFQPVIFREYDIRGVYNGQFDDNFAYLLGRAYVVYMKQNKNITNPTVALGCDARESSPAI
IKNLAKGLMDSGANVIHLGLVTTPVCYFATFELKVDGAVQVTGSHNPPEYNGFKISVGKG
TIFGVEIQKLLHIIQKGEFIDGQGSEESFDIKPMYYARYAKEFGHIKDTKVVLDCGNGAG
GSVVRGLFEACGLKPTILFEQPDGTFPNHHPDPTVEENLVDLKAQVLKEGAVAGIGFDGD
ADRIGVVDHTGRMVYGDELMVIISRAILAEQKGAKIIGDVKCSDRLYHDVAKHGGQPIMW
KTGHSLVKEKIKVEKAPFGGEMSGHVFFADRNHGYDDAPYAALRLVEILAKTGKTIPQLL
EGLPPSFNTPEIRIDTTEEKKVLIVEKMIEAFPAKEGADYKVDFTDGIRLSFADGWALCR
SSNTQPVVVVRYESSSQAGLDAIRNRVEAIVNKYL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaacccgtcatttttagagaatacgacattcgcggcgtctataacggacagttc
gacgacaactttgcttacctgctgggtcgcgcttacgtcgtttacatgaaacaaaacaag
aacatcactaatccaaccgtggcgttgggctgtgatgcgcgtgaaagctctccggccatc
atcaagaatcttgcaaaaggtctgatggattcaggcgcgaacgttattcacctgggtctg
gtaaccacgccggtttgttacttcgccacgtttgaattgaaagtcgatggcgcggttcag
gtaactggttcgcacaatcctccagaatacaacggctttaaaatttctgtgggtaaaggc
accatctttggcgtcgaaatccagaaacttttgcacatcattcaaaaaggcgaattcatt
gacggtcagggttcagaagaatctttcgacatcaagccaatgtactacgcacgttacgct
aaagaattcggccacatcaaagacaccaaagttgttttggactgcggtaacggtgctggc
ggatctgtggtgcgcggcttgtttgaagcctgcggtttgaaacccaccattttgtttgaa
cagccagatggcacattcccgaatcaccacccggatccaacggttgaagaaaacctggtg
gaccttaaggcccaggttcttaaagagggcgccgtggcgggcatcggctttgacggcgat
gccgaccgtatcggtgttgtcgatcacacgggccgcatggtttacggtgatgaattgatg
gtgatcatttcccgcgcgattttggctgaacaaaaaggggctaagatcattggcgatgtg
aagtgctctgatcgtctgtaccacgatgttgccaaacacggtggtcagccaatcatgtgg
aaaaccggacactctttggtgaaagaaaaaatcaaagttgaaaaagcgccattcggtggc
gagatgtccggtcacgtgttctttgccgaccgcaatcacggttacgatgatgctccttac
gcagctttgcgtttggtggaaatcctggcaaaaaccggcaaaacaattccacagttgctg
gaaggtttgcctccgtctttcaacactccagaaatccgcatcgacaccactgaagaaaag
aaggttctgatcgttgaaaaaatgattgaagctttcccggctaaagagggtgctgattat
aaagtggactttacggatggtatccgcctgagctttgctgacggctgggcactgtgccgc
tcttccaacacacagccagtggtggtggttcgttacgaatcctcgtcccaggcggggctg
gatgcgatccgcaaccgcgttgaagccatcgtaaacaagtatctttaa

DBGET integrated database retrieval system