KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_0045Help
Entry
Bdt_0045          CDS       T02356                                 

Definition
hypothetical protein
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
42643..43152
Genome map
AA seq 169 aa AA seqDB search
MSPVRHSALIYLTLDLVGGTEKAKALLAKLSECGDIVAISSVYKRYLTPERLDLSARMEF
VIRFETMMSVDQCLHVVLSGCAEGAPGLLQRSHAELTLLTFDDMILMSPRLTLPYPQLHQ
DPLIIRCAAEAWGQYEHPIYQKSLSEIARSALPAKQAEFHIQGKSLVDF
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctgtgcggcattcggcattgatatatctgacgctggatctggtcggcggcacg
gagaaggccaaagcacttttggctaaattgtcagagtgtggagacattgtggcgatttct
tcggtgtacaaacgttacctgactccggagcgtctggatctgagtgcccgcatggaattt
gtgatccgttttgaaaccatgatgtctgtggatcagtgtctgcacgtggttctttccggc
tgcgcggaaggggcgccgggtttgcttcagcgcagccatgctgaactgacccttttgact
ttcgatgacatgattctgatgtcaccgcgtttgacgcttccctatccgcaactgcaccag
gatccgcttattattcgctgtgccgcagaggcctgggggcaatatgagcatcccatctat
caaaagagcttaagcgaaattgcgcgctccgcccttcctgccaagcaggccgagttccat
attcagggtaaaagcctggttgatttttaa

DBGET integrated database retrieval system