KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_0119Help
Entry
Bdt_0119          CDS       T02356                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bdt_0119 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bdt_0119 (dapE)
Enzymes [BR:bbat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Bdt_0119 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
114378..115724
Genome map
AA seq 448 aa AA seqDB search
MDFIEACRQLIAIDSSPTHGNKELSKWVAAFCRQRGLHVEEQEEVVGDLEQANVIARPVA
ERPEAEFLLQTHLDTVDPGPFSLWTDTGSNPFDAHIIDGKIYGLGAADVKLDFLCKLEAL
ASFGADRAWRLPPVLVGTFGEESGMQGALKLIRKNKISAKMALIGEPSDLRVINAAKGFA
SVEIHVPFSDEEMRYREEHNMRESTSTQSKIFRGKAAHSSTPHLGESAIAKMFEYLMMLP
DSVNVMEMDGGINFNTVPSHAFLEIDMVTQIAEPISRKIANIYRAVKALELEFLDHKDDD
FYPTTPTLNIGLIRTNEGDIQISGSCRIPPVITHEIYEGWMDRLRQVCEANGATFRVNDY
KKPFRTEVTSILAKGCLDELRAMGLDDKPITQASTNEASIFSRVGIECVCFGPGKREGNV
HTPQEHVLIEDLHKAIEFYKRIIERFCL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttggacttcatcgaggcctgccgacaactgatcgctatcgacagctcacccacccacggc
aataaagaattgtccaagtgggtggcggccttttgccgtcagcgtggattgcacgttgaa
gaacaagaggaagttgtcggggaccttgagcaggcaaatgtgattgcccgccccgtggca
gagcgcccggaagctgagttcctgctgcaaacgcatctggatacagtggaccccgggcct
ttttcgctttggacggacacgggcagcaatccgtttgatgcgcatatcatcgatggaaaa
atctacggcctgggggctgcggatgtgaagctggatttcctttgcaaactggaagctctg
gcgtctttcggtgccgaccgtgcgtggcgtttgccgccggtgctggttggaacctttggt
gaagaatccggcatgcagggggccctgaaactgattcgcaaaaacaagatttctgcgaag
atggccttgatcggggagcccagcgacttgcgcgtgattaatgcggccaagggttttgcc
agtgttgaaattcacgtgccgttctcggatgaagagatgcgctatcgtgaagaacacaac
atgcgtgaaagcacctcgacacagtcgaaaattttccgcggcaaggcggcccactcttcc
actcctcatttgggggaaagtgcgattgccaagatgtttgaatatctcatgatgctgccg
gattcggtgaacgtcatggagatggatggcggcattaactttaacaccgttcccagtcat
gcatttttggaaatcgatatggtgacccagattgccgaacctatttcccgcaagattgcc
aatatctatcgcgcggtgaaggctttggagctggagtttttggatcacaaggatgatgat
ttttatccgacgacgccgacactgaatattggacttatccgcacgaatgaaggtgacatt
cagatttctggttcctgccgtatccctccggtgatcacgcatgaaatctatgaaggctgg
atggatcgtctgcgccaggtgtgcgaagccaacggcgccaccttccgcgtgaatgattat
aaaaaacccttccgaaccgaagtgacttcgattctggctaagggatgtctggatgaactg
cgggcgatgggtcttgatgacaagccgatcacccaggcttcgacgaacgaagccagcatc
ttcagccgcgtgggcattgaatgtgtgtgtttcggtcccggcaaaagggaaggaaacgta
cacacccctcaagagcatgtcttgattgaggatctacacaaagcaatagagttttataaa
aggatcatcgaaaggttttgtttatga

DBGET integrated database retrieval system