KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_0136Help
Entry
Bdt_0136          CDS       T02356                                 

Gene name
bglX2
Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbat00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bbat00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(131284..132396)
Genome map
AA seq 370 aa AA seqDB search
MSISHIIGQHMFIGVSGHALTADEKKFIVENNIGGVCLFGRNVAEPKQVRDLCAEIQSLR
HKQVDKAPLFIGIDMEGGRVHRLKAPFTVWPPLRKLGDLDAPTVSFHFANRMGLEMKAVG
INLDFAPCVDIFTNPGNTVIGDRSISSDPEMVAKHASALVRGYIKADVITCAKHFPGHGN
TIVDSHEDLPVENTDLARLEACELIPFRKTFKSRVDMVMTSHIKFPNIDPEWPVTLSETF
VKKMIREELRYRGLIITDDLGMKAMTKHYGIDEVPVRALKAGVDLLLYCNDPEVPPQAYD
AILGAVAQGSLKKEDLEISYRRIMDFKKVKIQNPDPLPLEDAIKIIGSPEHLKIASAIAN
GQIPDGLLPE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcagtcacatcatcggtcagcacatgttcatcggcgtatcaggtcacgccctt
accgctgacgaaaagaagttcattgtagaaaacaacatcggtggtgtgtgcctgtttggc
cgtaacgtcgctgaaccaaaacaggttcgcgatctgtgcgccgaaatccagtccctgcgt
cacaagcaagtcgacaaagcaccgctgtttatcggtattgatatggaaggtggccgcgtt
caccgtctgaaagctccatttacggtgtggccaccactgagaaaactgggcgatctggat
gcaccaaccgtgtctttccattttgccaaccgcatgggccttgaaatgaaagccgtgggc
atcaatctggatttcgcaccttgtgtggatatcttcacaaacccaggcaacaccgttatc
ggcgaccgttccatcagctctgatcccgagatggtggcaaaacacgcttcggctctggtt
cgtggttacatcaaagcggatgtcatcacttgcgcgaagcacttcccgggacatggtaac
accatcgttgacagtcacgaggacctgccggttgaaaacaccgatctggcccgccttgaa
gcctgcgagctgattccgttcagaaagaccttcaagtctcgcgtggatatggtcatgacc
tcacacatcaagttcccgaacatcgatcctgagtggccagtgactttgtcagagacattc
gtgaagaaaatgattcgcgaagaacttcgctatcgcggtttgatcatcactgatgacttg
ggaatgaaagccatgacgaagcactatggaattgacgaggttccagtgcgcgccttgaaa
gccggcgtggatctgctgctttactgcaatgatcccgaggttccgccgcaggcctacgat
gccatcctgggtgccgtggcccaaggatctttaaaaaaagaagaccttgaaatcagctat
cgtcgcatcatggactttaagaaggtaaaaattcagaaccctgatccacttcccttggaa
gatgcgatcaaaatcatcggcagtccggaacacctgaagatcgcttccgcgatcgccaat
ggtcagattcccgacgggcttttgccagaataa

DBGET integrated database retrieval system