KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_0336Help
Entry
Bdt_0336          CDS       T02356                                 

Definition
lipase/acylhydrolase domain-containing protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bdt_0336
Enzymes [BR:bbat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bdt_0336
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Bdt_0336
Lipid biosynthesis proteins [BR:bbat01004]
 Fatty acid synthase
  Component type
   Bdt_0336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341699..342298
Genome map
AA seq 199 aa AA seqDB search
MRPFLFLLILLCSSFSFAQKKLIVLGDSLTEGYGVAKEAAFPAVLEKKLHASGKKEWTII
NAGVSGSTTASGLSRMKWVFKSKPDVVLLALGANDGLRGLKVEDSEKHLAQSIEYAQSQK
VKVILGGLYMPPNYGKDYTDKFKKMYESLAKKYKLTFIPFILDKVAGNPKYNLADGIHPN
EEGHKIIADNVFSVLKGAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagaccttttttatttctcctcattcttctttgcagctctttttccttcgcacaaaaa
aaactgatcgtcctgggtgattcgctcaccgaaggatatggtgttgccaaagaggcggcg
tttccggccgtccttgaaaagaaacttcacgcgtctggcaaaaaagaatggaccatcatc
aatgccggggtcagtggttccaccacggcgtcaggtcttagccgtatgaagtgggtcttt
aaatcaaaaccagatgtcgtattgctggcgctgggggcgaacgatggtttgcgcggtctg
aaggtcgaagacagtgaaaaacatctggcccagtccatcgaatatgcgcaatctcagaaa
gtaaaagtcatcttgggtggtttgtatatgccgccgaattacggcaaagactataccgat
aaattcaaaaaaatgtacgagtcgcttgctaagaaatacaagctgaccttcattccgttc
atcctggacaaggtggcgggaaatccaaaatacaatctggccgacgggattcatcccaac
gaagaaggtcataagataatcgcagacaatgtgttttcagttctaaagggggcgttgtga

DBGET integrated database retrieval system