KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_0349Help
Entry
Bdt_0349          CDS       T02356                                 

Definition
(GenBank) putative arginase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
bbat00330  Arginine and proline metabolism
bbat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bdt_0349
Enzymes [BR:bbat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Bdt_0349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489 BshC
Motif
Other DBs
NCBI-ProteinID: AFY00057
UniProt: K7ZE13
Position
complement(351839..352894)
Genome map
AA seq 351 aa AA seqDB search
MSEKTVKFDPTTTISAEFGIFGIPMTEDESKVVLVPVPWEVTTSYGEGASRGPQIIRQAS
EQIDLFDIEVGKAYEVGYHMRDFPEDLCNMNDKFKAVAQELIGMRTNMSDDEAKMNKLAS
QVNEACEEMTQWVYDQCSNVLKKGKLLGLVGGDHSTPLGAIRAVSDKLKGEFGVLHIDAH
ADLRTAYQGFKQSHASIMYNVMTDAKKPQKLVQVGIRDFCEEEYDFSNSREDIKTFYDLE
LKRRMLKGETWEQVCKDIIKELPQNVYISFDIDGLDPAFCPHTGTPVPGGLSVDQVFFLF
REVHASGRKIVAFDLNEVSTGGLPEGEVEWDGNVGARILYKMCGWLVKSNA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaagactgtgaaattcgacccgacaaccaccatctctgcagagttcggaatc
ttcggaattccgatgaccgaagacgagtccaaggtcgttctagttccagttccctgggaa
gtaaccacctcttatggcgaaggcgcttctcgcgggcctcagatcatccgccaagccagt
gaacagattgaccttttcgacattgaagtcggcaaagcctacgaagtcggctaccacatg
cgcgatttccctgaagacctgtgcaacatgaacgacaagttcaaggccgtggctcaggaa
ctgatcggaatgcgcaccaacatgagcgacgacgaagccaaaatgaacaagctggcttcc
caggtgaacgaagcctgcgaagagatgacccaatgggtttacgaccagtgctctaacgtc
ctgaaaaagggcaagctgctgggtctggttggtggcgatcactccaccccgcttggagcc
atccgcgccgtcagcgataaactcaaaggcgagttcggcgttttgcacatcgatgctcac
gcggatctgcgcacggcttaccagggcttcaaacaatcccacgcttccatcatgtacaac
gtgatgactgatgctaaaaagcctcagaagctggttcaagtcggcatccgtgacttctgc
gaggaagaatacgacttcagcaactcccgtgaagacatcaagaccttctacgacctggag
ctgaaacgccgcatgctgaaaggcgaaacctgggaacaagtctgcaaagacatcatcaaa
gaacttccgcagaacgtgtacatctcttttgatatcgacggtctggatccggccttctgc
cctcacactggcacacctgttccgggcggcttgagcgtggatcaggtcttcttcctgttc
cgtgaagtgcatgcttccggccgcaagatcgtggcttttgacctgaatgaagtttccacc
ggcggcttgcctgaaggcgaagttgaatgggatggcaacgtgggcgcgcgtattttgtac
aaaatgtgcggctggttggtgaaatccaatgcttaa

DBGET integrated database retrieval system