KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_0702Help
Entry
Bdt_0702          CDS       T02356                                 

Gene name
choA
Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Bdt_0702 (choA)
Enzymes [BR:bbat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Bdt_0702 (choA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(717261..718949)
Genome map
AA seq 562 aa AA seqDB search
MKLDYDYIVIGSGFGGSVMTCRLVEKGYKVCLMERGRQWKIGQFPRRPHDVQQRMFWDPE
DQKYGLMEMRDTPESDVLSLTASGLGGGSLIYANVLYRMPDRFFQGWPQIYNRKSLDPFY
DRVLHMMEAKPYPYETQNYYKATPKTALLKRLAEEMPPPPDSVGKPSFNLPPLGVRFEGS
FPGHQTHNMHGALQSKCNKCGDCDIGCNINAKNSLDLNYIFRARNLKTSEHPADIRTHAD
VVRIEHFGDYYKVTYVIPEFPQQETTFTAKNVVLSAGSIGSTSLLLKMKKQGHLPKLNIW
LGKKWSGNGDLLGLIFGSRENIDATNGPVITGAIEYNFKDYDDGYHHGMYLQEAGFPVGF
AWYLSGKIPQLPGIRGLGTLFARSIKKYVFKILNLESRDQVNVGEEFAQAIDRADFTKRC
FVLLGMGRDKPDGEIRLRSDNQAIIKWKMDGSKLHFDRLRTQMKKIAERIGGVFVDNPLT
HLNKVVAVHPLGGCPMGETSDTGFVNPLGEVYGYKGLFVVDGSILPSSTGPNPSLTIAAV
AEYIAEQIPNKVTTKSKETQEA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggactatgactatatcgtgatcggttctggttttggcggatcggtcatgacc
tgccgcttggttgaaaaaggctataaagtctgcctgatggaacgtggccgtcagtggaag
ataggtcaatttccacgtcgcccccacgatgtgcaacagcgtatgttctgggatcccgaa
gaccagaaatacggtctgatggaaatgcgggatacgccggaaagtgatgtcctgtcgctg
acagccagcggactgggtggtggcagtctgatttatgccaatgttctttaccgaatgccc
gacagattcttccagggctggccgcagatctacaaccgtaaaagtcttgatccattttac
gaccgggttctacatatgatggaggccaagccctacccttatgaaacgcaaaactactac
aaggccactccaaaaaccgcgcttttaaaaaggttggcggaagaaatgccgccaccgccg
gattcggtcggaaaacccagctttaatctgccgcccttgggggtacgttttgaaggcagc
tttcccggacatcaaacccacaacatgcatggggccttgcaatccaagtgcaacaaatgc
ggtgattgcgacatcggttgtaacatcaatgccaagaactctttggatttgaattatatt
ttccgcgcccggaatttgaagacatctgaacatcctgccgacattcgcactcacgcggat
gtggtgcgtatcgagcactttggtgactattataaagtgacttatgtcattccggaattc
ccacaacaagaaaccacttttactgcgaaaaatgtggtgctgtcagccgggtctatcgga
tcgacttccctgctgttgaaaatgaaaaaacaggggcacctgccaaaattgaacatctgg
ctgggaaaaaagtggagcggcaatggtgatttgctgggattgatttttggatcccgcgaa
aatatcgacgccaccaatggtccggttattaccggtgcaattgaatataacttcaaggac
tatgacgatggttatcaccatggaatgtacctgcaggaggccggattcccggtgggcttt
gcctggtatctttccggaaaaatccctcagctgccgggcattcgcggactagggacgctg
tttgcccgcagtatcaagaaatacgtctttaagattctgaatctcgaaagccgcgaccag
gtcaacgtcggtgaagagttcgcccaggccattgatcgcgcggacttcaccaagcgctgc
tttgtgcttttgggcatgggtcgtgacaaacccgacggagaaatccgtctgcgctcggac
aatcaggccatcatcaaatggaaaatggacggcagcaaattgcactttgatcgcctgcgc
acgcaaatgaagaaaatcgccgagcgtattggtggagtttttgtcgacaacccgctgact
cacttgaataaagtcgtggccgttcaccctctgggcggttgcccgatgggggaaacctct
gacacgggcttcgtaaatccactgggcgaagtgtacggatataaaggtttgttcgtcgta
gacggcagcatcctgccctcttccactggccccaacccttcactgaccattgccgcggtc
gccgaatacatcgctgagcagattccaaacaaagtaaccacaaaaagcaaagagacccag
gaagcctag

DBGET integrated database retrieval system