KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_0741Help
Entry
Bdt_0741          CDS       T02356                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
bbat00010  Glycolysis / Gluconeogenesis
bbat00020  Citrate cycle (TCA cycle)
bbat00620  Pyruvate metabolism
bbat01100  Metabolic pathways
bbat01110  Biosynthesis of secondary metabolites
bbat01120  Microbial metabolism in diverse environments
bbat01130  Biosynthesis of antibiotics
bbat01200  Carbon metabolism
Module
bbat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bdt_0741 (pdhC)
   00020 Citrate cycle (TCA cycle)
    Bdt_0741 (pdhC)
   00620 Pyruvate metabolism
    Bdt_0741 (pdhC)
Enzymes [BR:bbat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bdt_0741 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFY00448
UniProt: K7YS80
Position
complement(755515..757161)
Genome map
AA seq 548 aa AA seqDB search
MNNERNSRNMATDVKLPELGEGVTEGELVKWLVKPGDAVKADQAIAEVLTDKATVEVPSP
VAGVVKDLKFKSGDVVKVGATMITLDGAGAAKPAAAQPAAAAPAPAASTPAPAAGGGGKA
QDVKLPELGEGVTEGELVKWLVKPGDSVKADQAIAEVLTDKATVEVPTPVAGVVKELKFK
SGDVVKVGSTMIILEGAGGAAAPKAAPSAGPVQSAPAHSAAPAAKAAPVATASSDIFPPV
ADSKVLATPATRRLAREMGVDINSLSGTGLAGRVTREDVMSSNGGAGSAAAKPQQSAASA
TMSIPKPSYQGPAGAAEERVPLIGIRKKIAENMQRSKHVIPHFTIMDEAKVDAMVALRES
LKEHAEKNGTKITYLPIVMKALIATIREFPMFNASIDDAAGEIVYKKYFNLGFAADTPNG
LVVPVIKNADQKSILEISKEILDLSKRARDGKLKPDEMKGATITVTNIGSIGGTYATPVI
NHPEVAILGMYKIDEKVVLKNGQVSAIKVMNYTMTADHRLIDGAVAARFLAAFIGRIENP
GKLLVELI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgaaaggaactctcgcaacatggcaactgatgtgaaactgcccgagcttgga
gaaggcgttactgaaggtgaattggtaaaatggttggtaaaaccaggcgatgcggtcaaa
gctgaccaggctatcgcagaagtattgactgacaaagcaacggtagaggttccgtcaccg
gttgcgggtgtcgtaaaagatcttaaattcaaatccggcgacgtagtaaaagtcggcgcg
actatgatcactcttgatggtgcaggcgctgcaaaaccggcagccgctcaaccagcggcg
gcggctccggctcctgcagcttccactccagctccggctgcaggtggtggtggtaaagct
caagacgtgaaattgcctgaactgggcgagggcgtgactgaaggcgaacttgttaaatgg
ttggtaaaaccaggtgactctgtaaaagcggatcaggcgattgctgaagttctgactgac
aaagcgactgtggaagttccgactccagtggctggtgttgtaaaagaattgaaattcaaa
tccggcgacgtagtcaaagtcggttccaccatgatcatccttgagggtgcaggtggcgcg
gcagctccgaaagcggctccaagtgctggtccagtgcagtctgcgcctgcacactccgcg
gctcccgccgccaaagcagcaccagtggcgactgcttccagcgacatcttcccacctgtg
gcagactccaaagtattggcgactccggcgactcgtcgtctggctcgtgaaatgggcgtt
gatatcaattccctttccggtactggtcttgcaggtcgcgtgactcgtgaagatgtcatg
tcttccaacggcggcgctggttcagctgcggcgaaacctcagcaatccgcggcttccgcc
accatgtctattcctaagccttcttaccagggcccggcgggcgcagctgaagagcgcgtt
cctctgatcggtatccgtaagaaaatcgctgaaaacatgcagcgttccaagcacgtgatc
ccgcacttcaccatcatggatgaagcgaaagtggatgcgatggttgctcttcgcgaaagc
ctgaaagaacacgcagagaaaaacggcacgaagatcacttaccttcctatcgttatgaag
gccttgattgcaacgatccgcgaattcccgatgttcaatgcatccatcgacgatgcagct
ggcgaaatcgtttacaaaaagtacttcaacctgggcttcgcagccgacactccaaacggc
cttgtcgttccagtgatcaaaaacgcagaccagaaatccatcctggaaatctccaaagag
atcctggatctttccaagcgtgctcgtgacggcaagttgaaaccggatgaaatgaagggt
gcaaccatcactgtgacgaacatcggttctatcggtggcacttatgcgactcctgtgatc
aaccaccctgaagtggcgatcctgggcatgtacaaaatcgacgaaaaagtggttctgaaa
aacggccaggtttccgcgattaaagttatgaactacacaatgactgccgatcaccgtttg
atcgacggcgctgtggctgcaagattccttgctgccttcatcggccgcatcgaaaatcca
ggcaaactattggtggagctgatttaa

DBGET integrated database retrieval system